| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6841 | g6841.t6 | TTS | g6841.t6 | 19025411 | 19025411 |
| chr_2 | g6841 | g6841.t6 | isoform | g6841.t6 | 19026102 | 19030319 |
| chr_2 | g6841 | g6841.t6 | exon | g6841.t6.exon1 | 19026102 | 19026356 |
| chr_2 | g6841 | g6841.t6 | cds | g6841.t6.CDS1 | 19026103 | 19026356 |
| chr_2 | g6841 | g6841.t6 | exon | g6841.t6.exon2 | 19030184 | 19030319 |
| chr_2 | g6841 | g6841.t6 | cds | g6841.t6.CDS2 | 19030184 | 19030319 |
| chr_2 | g6841 | g6841.t6 | TSS | g6841.t6 | 19030587 | 19030587 |
>g6841.t6 Gene=g6841 Length=391
ATGGCGGATAAAAATAAGTCAGATGGAGATGCATATCTTAATCGTCCTGAGAAACTTGGT
GCTTGGGATGGCTTTAAGCAATTTCTGTGGAATTCGGACACGAAGCAATTTATGGGCAGA
ACAAGCGGCAGTTGGTTGCGTATCCTCATCTTTTACATCATTTTCTACATCGTATTGGCC
ATTTTCTTTGTAACAATGTTTTTCATATTTGGTTCAACATTGACAAAAGAGCGACCAAAA
TATGAGCTAAAAGAGAGTCTGATTGGCACAAATCCAGGTTTAGGTTTTCGACCAATGCCC
CCAGAAAGTAACGTTGAAAGTACATTAATTTGGTATCAAAAGGACAATCCAGATAATTCT
AAATATTGGGTTGAGGAGATTGATCGTTTTT
>g6841.t6 Gene=g6841 Length=130
MADKNKSDGDAYLNRPEKLGAWDGFKQFLWNSDTKQFMGRTSGSWLRILIFYIIFYIVLA
IFFVTMFFIFGSTLTKERPKYELKESLIGTNPGLGFRPMPPESNVESTLIWYQKDNPDNS
KYWVEEIDRF
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g6841.t6 | Gene3D | G3DSA:2.60.40.1660 | Na | 16 | 130 | 4.3E-35 |
| 2 | g6841.t6 | PANTHER | PTHR11523:SF46 | SODIUM/POTASSIUM-TRANSPORTING ATPASE SUBUNIT BETA-2 | 10 | 130 | 6.8E-31 |
| 3 | g6841.t6 | PANTHER | PTHR11523 | SODIUM/POTASSIUM-DEPENDENT ATPASE BETA SUBUNIT | 10 | 130 | 6.8E-31 |
| 1 | g6841.t6 | Pfam | PF00287 | Sodium / potassium ATPase beta chain | 20 | 130 | 1.6E-33 |
| 8 | g6841.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 44 | - |
| 9 | g6841.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 45 | 70 | - |
| 7 | g6841.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 71 | 130 | - |
| 5 | g6841.t6 | ProSitePatterns | PS00390 | Sodium and potassium ATPases beta subunits signature 1. | 25 | 45 | - |
| 4 | g6841.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 70 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006813 | potassium ion transport | BP |
| GO:0005890 | sodium:potassium-exchanging ATPase complex | CC |
| GO:0006814 | sodium ion transport | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed