| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6846 | g6846.t2 | TSS | g6846.t2 | 19116151 | 19116151 |
| chr_2 | g6846 | g6846.t2 | isoform | g6846.t2 | 19116449 | 19116887 |
| chr_2 | g6846 | g6846.t2 | exon | g6846.t2.exon1 | 19116449 | 19116509 |
| chr_2 | g6846 | g6846.t2 | cds | g6846.t2.CDS1 | 19116449 | 19116509 |
| chr_2 | g6846 | g6846.t2 | exon | g6846.t2.exon2 | 19116604 | 19116887 |
| chr_2 | g6846 | g6846.t2 | cds | g6846.t2.CDS2 | 19116604 | 19116887 |
| chr_2 | g6846 | g6846.t2 | TTS | g6846.t2 | NA | NA |
>g6846.t2 Gene=g6846 Length=345
ATGCAAAAAAATTACAGTCATTGTCCGCTTAAAAAGCGTCCAGTCTTTATCGTCAAAGAA
GAATCAGATTCAGAAATGGAACCAGAAAATTTGAGCACAAAACCACAAGATTTACTTCTT
CGTACTGAAAAATTACAAGCAAAATCACTAAAAATGGAAAATGAGACGAAAAAAATTATT
GAAGAAATCAGACTCGTTTCGCCAAAGTCACCAGCAGTAGCATCAGAACCAGTGTATGAA
TATCCCAAATCACCAATTCCAACACATAAAACAAAGTCAGAAATTTCACCAGCTTCATCA
CCTTCAATGGAACCATTGAATTTTTCAAATCCTTCATCATGGCAT
>g6846.t2 Gene=g6846 Length=115
MQKNYSHCPLKKRPVFIVKEESDSEMEPENLSTKPQDLLLRTEKLQAKSLKMENETKKII
EEIRLVSPKSPAVASEPVYEYPKSPIPTHKTKSEISPASSPSMEPLNFSNPSSWH
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g6846.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 69 | 115 | - |
| 1 | g6846.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 89 | 115 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed