General information for g6899.t35
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Guanine nucleotide-binding protein subunit beta-like protein.
Parent gene
- The parent gene g6899 is located on chr_2: 19757258..19758555 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6899 | g6899.t35 | TSS | g6899.t35 | 19756988 | 19756988 |
| chr_2 | g6899 | g6899.t35 | isoform | g6899.t35 | 19757065 | 19758475 |
| chr_2 | g6899 | g6899.t35 | exon | g6899.t35.exon1 | 19757065 | 19757173 |
| chr_2 | g6899 | g6899.t35 | cds | g6899.t35.CDS1 | 19757065 | 19757173 |
| chr_2 | g6899 | g6899.t35 | exon | g6899.t35.exon2 | 19757245 | 19757398 |
| chr_2 | g6899 | g6899.t35 | cds | g6899.t35.CDS2 | 19757245 | 19757398 |
| chr_2 | g6899 | g6899.t35 | exon | g6899.t35.exon3 | 19757458 | 19757512 |
| chr_2 | g6899 | g6899.t35 | cds | g6899.t35.CDS3 | 19757458 | 19757512 |
| chr_2 | g6899 | g6899.t35 | exon | g6899.t35.exon4 | 19757837 | 19758043 |
| chr_2 | g6899 | g6899.t35 | cds | g6899.t35.CDS4 | 19757837 | 19758043 |
| chr_2 | g6899 | g6899.t35 | exon | g6899.t35.exon5 | 19758119 | 19758475 |
| chr_2 | g6899 | g6899.t35 | cds | g6899.t35.CDS5 | 19758119 | 19758475 |
| chr_2 | g6899 | g6899.t35 | TTS | g6899.t35 | 19758558 | 19758558 |
Sequences
>g6899.t35 Gene=g6899 Length=882
ATGACCGAAACTTTGCAATTAAAAGGAACTCTTATCGGCCATTCAGGATGGGTAACTCAA
ATTGCTACTAATCCCAAATATCCTGATATGATTTTGTCATCGTCTCGAGACAAGACTTTG
ATTGTATGGCGTTTATTGCGTGAAGCTAATAGCTACGGTATTCCTCAAAAGCGTTTGTAT
GGACACAGCCATTTTATCAGTGACGTTGTTCTCTCATCTGACGGAAATTATGCTCTTTCT
GGATCATGGGACAAGACTTTGAGATTGTGGGATTTGGCAGCAGGAAAATCAACTCGTCGT
TTTGAGGATCACACAAAGGATGTGCTCTCAGTTGCTTTTAGCGCTGACAATCGTCAAATC
GTTTCTGGCTCACGCGATAAGACTATTAAATTGTGGAATACATTAGCCGAGTGCAAATAC
ACCATTCAAGAAGATGGCCACTCTGACTGGGTCTCATGCGTTCGTTTCTCACCAAATCAA
GTAAATCCAATCATTGTTTCTGCTGGTTGGGATAAAACTGTTAAGTCACCTGATGGTTCA
TTGTGCACATCAGGCGGTAAGGACTACAAGGCTTTGTTGTGGGATTTGAATGACGGCAAG
CACTTGCACACACTTGAACATAACGACATCATCAATGCCTTATGCTTCTCACCAAACCGC
TACTGGTTGTGCGTTGCTTACGGATCATCAATCAAGATTTGGGATTTGGCATGCAAGAAA
ATGGTTGAAGAATTGCGTCCAGGTGTCTCGACAAACGATTCATCAAAGGCTGATCCACCA
CAGTGCTTGTCACTTGCTTGGTCAACTGATGGACAAACTTTGTTTGCCGGCTACAGCGAT
AACAAGATTCGCGTTTGGCAAGTTTCAGTTACTGCTCGTTAA
>g6899.t35 Gene=g6899 Length=293
MTETLQLKGTLIGHSGWVTQIATNPKYPDMILSSSRDKTLIVWRLLREANSYGIPQKRLY
GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKSTRRFEDHTKDVLSVAFSADNRQI
VSGSRDKTIKLWNTLAECKYTIQEDGHSDWVSCVRFSPNQVNPIIVSAGWDKTVKSPDGS
LCTSGGKDYKALLWDLNDGKHLHTLEHNDIINALCFSPNRYWLCVAYGSSIKIWDLACKK
MVEELRPGVSTNDSSKADPPQCLSLAWSTDGQTLFAGYSDNKIRVWQVSVTAR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 14 | g6899.t35 | CDD | cd00200 | WD40 | 7 | 287 | 2.16923E-80 |
| 13 | g6899.t35 | Gene3D | G3DSA:2.130.10.10 | - | 8 | 293 | 2.5E-110 |
| 8 | g6899.t35 | PANTHER | PTHR19868 | RECEPTOR FOR ACTIVATED PROTEIN KINASE C RACK1 | 1 | 175 | 1.7E-135 |
| 7 | g6899.t35 | PANTHER | PTHR19868 | RECEPTOR FOR ACTIVATED PROTEIN KINASE C RACK1 | 176 | 290 | 1.7E-135 |
| 9 | g6899.t35 | PRINTS | PR00320 | G protein beta WD-40 repeat signature | 78 | 92 | 8.8E-8 |
| 11 | g6899.t35 | PRINTS | PR00320 | G protein beta WD-40 repeat signature | 120 | 134 | 8.8E-8 |
| 10 | g6899.t35 | PRINTS | PR00320 | G protein beta WD-40 repeat signature | 182 | 196 | 8.8E-8 |
| 2 | g6899.t35 | Pfam | PF00400 | WD domain, G-beta repeat | 6 | 43 | 0.0012 |
| 3 | g6899.t35 | Pfam | PF00400 | WD domain, G-beta repeat | 55 | 91 | 1.4E-7 |
| 5 | g6899.t35 | Pfam | PF00400 | WD domain, G-beta repeat | 96 | 133 | 7.2E-8 |
| 1 | g6899.t35 | Pfam | PF00400 | WD domain, G-beta repeat | 140 | 175 | 0.0017 |
| 6 | g6899.t35 | Pfam | PF00400 | WD domain, G-beta repeat | 199 | 235 | 2.3E-5 |
| 4 | g6899.t35 | Pfam | PF00400 | WD domain, G-beta repeat | 264 | 286 | 0.0024 |
| 15 | g6899.t35 | ProSitePatterns | PS00678 | Trp-Asp (WD) repeats signature. | 78 | 92 | - |
| 17 | g6899.t35 | ProSitePatterns | PS00678 | Trp-Asp (WD) repeats signature. | 120 | 134 | - |
| 16 | g6899.t35 | ProSitePatterns | PS00678 | Trp-Asp (WD) repeats signature. | 182 | 196 | - |
| 24 | g6899.t35 | ProSiteProfiles | PS50294 | Trp-Asp (WD) repeats circular profile. | 11 | 293 | 38.784 |
| 26 | g6899.t35 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 11 | 45 | 10.742 |
| 27 | g6899.t35 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 59 | 100 | 15.287 |
| 29 | g6899.t35 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 101 | 133 | 15.22 |
| 28 | g6899.t35 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 176 | 204 | 8.804 |
| 25 | g6899.t35 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 264 | 293 | 10.375 |
| 19 | g6899.t35 | SMART | SM00320 | WD40_4 | 4 | 44 | 7.1E-7 |
| 23 | g6899.t35 | SMART | SM00320 | WD40_4 | 52 | 91 | 3.7E-7 |
| 18 | g6899.t35 | SMART | SM00320 | WD40_4 | 94 | 133 | 4.9E-10 |
| 21 | g6899.t35 | SMART | SM00320 | WD40_4 | 135 | 195 | 0.0013 |
| 22 | g6899.t35 | SMART | SM00320 | WD40_4 | 198 | 235 | 2.1E-5 |
| 20 | g6899.t35 | SMART | SM00320 | WD40_4 | 252 | 287 | 0.25 |
| 12 | g6899.t35 | SUPERFAMILY | SSF50978 | WD40 repeat-like | 4 | 287 | 1.2E-64 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed