General information for g6899.t5
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Guanine nucleotide-binding protein subunit beta-like protein.
Parent gene
- The parent gene g6899 is located on chr_2: 19757258..19758555 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6899 | g6899.t5 | TSS | g6899.t5 | 19756988 | 19756988 |
| chr_2 | g6899 | g6899.t5 | isoform | g6899.t5 | 19757065 | 19758107 |
| chr_2 | g6899 | g6899.t5 | exon | g6899.t5.exon1 | 19757065 | 19757173 |
| chr_2 | g6899 | g6899.t5 | cds | g6899.t5.CDS1 | 19757065 | 19757173 |
| chr_2 | g6899 | g6899.t5 | exon | g6899.t5.exon2 | 19757245 | 19757398 |
| chr_2 | g6899 | g6899.t5 | cds | g6899.t5.CDS2 | 19757245 | 19757398 |
| chr_2 | g6899 | g6899.t5 | exon | g6899.t5.exon3 | 19757458 | 19757512 |
| chr_2 | g6899 | g6899.t5 | cds | g6899.t5.CDS3 | 19757458 | 19757512 |
| chr_2 | g6899 | g6899.t5 | exon | g6899.t5.exon4 | 19757860 | 19758107 |
| chr_2 | g6899 | g6899.t5 | cds | g6899.t5.CDS4 | 19757860 | 19757865 |
| chr_2 | g6899 | g6899.t5 | TTS | g6899.t5 | 19758558 | 19758558 |
Sequences
>g6899.t5 Gene=g6899 Length=566
ATGACCGAAACTTTGCAATTAAAAGGAACTCTTATCGGCCATTCAGGATGGGTAACTCAA
ATTGCTACTAATCCCAAATATCCTGATATGATTTTGTCATCGTCTCGAGACAAGACTTTG
ATTGTATGGCGTTTATTGCGTGAAGCTAATAGCTACGGTATTCCTCAAAAGCGTTTGTAT
GGACACAGCCATTTTATCAGTGACGTTGTTCTCTCATCTGACGGAAATTATGCTCTTTCT
GGATCATGGGACAAGACTTTGAGATTGTGGGATTTGGCAGCAGGAAAATCAACTCGTCGT
TTTGAGGATCACACAAAGCGCTGACAATCGTCAAATCGTTTCTGGCTCACGCGATAAGAC
TATTAAATTGTGGAATACATTAGCCGAGTGCAAATACACCATTCAAGAAGATGGCCACTC
TGACTGGGTCTCATGCGTTCGTTTCTCACCAAATCAAGTAAATCCAATCATTGTTTCTGC
TGGTTGGGATAAAACTGTTAAGGTCTGGAACTTGGCAAACTGCAAATTGAAGTTGAACCA
TTACGGTCACAATGGATACTTGAATA
>g6899.t5 Gene=g6899 Length=107
MTETLQLKGTLIGHSGWVTQIATNPKYPDMILSSSRDKTLIVWRLLREANSYGIPQKRLY
GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKSTRRFEDHTKR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g6899.t5 | Gene3D | G3DSA:2.130.10.10 | - | 8 | 107 | 3.9E-36 |
| 3 | g6899.t5 | PANTHER | PTHR19868:SF0 | RECEPTOR OF ACTIVATED PROTEIN C KINASE 1 | 1 | 106 | 6.7E-44 |
| 4 | g6899.t5 | PANTHER | PTHR19868 | RECEPTOR FOR ACTIVATED PROTEIN KINASE C RACK1 | 1 | 106 | 6.7E-44 |
| 1 | g6899.t5 | Pfam | PF00400 | WD domain, G-beta repeat | 6 | 43 | 2.0E-4 |
| 2 | g6899.t5 | Pfam | PF00400 | WD domain, G-beta repeat | 55 | 91 | 2.4E-8 |
| 8 | g6899.t5 | ProSitePatterns | PS00678 | Trp-Asp (WD) repeats signature. | 78 | 92 | - |
| 10 | g6899.t5 | ProSiteProfiles | PS50294 | Trp-Asp (WD) repeats circular profile. | 11 | 107 | 20.856 |
| 11 | g6899.t5 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 11 | 45 | 10.742 |
| 12 | g6899.t5 | ProSiteProfiles | PS50082 | Trp-Asp (WD) repeats profile. | 59 | 100 | 15.287 |
| 6 | g6899.t5 | SMART | SM00320 | WD40_4 | 4 | 44 | 7.1E-7 |
| 7 | g6899.t5 | SMART | SM00320 | WD40_4 | 52 | 91 | 3.7E-7 |
| 5 | g6899.t5 | SUPERFAMILY | SSF50978 | WD40 repeat-like | 4 | 105 | 1.16E-24 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
