| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6957 | g6957.t39 | TTS | g6957.t39 | 20173716 | 20173716 |
| chr_2 | g6957 | g6957.t39 | isoform | g6957.t39 | 20174642 | 20177053 |
| chr_2 | g6957 | g6957.t39 | exon | g6957.t39.exon1 | 20174642 | 20174887 |
| chr_2 | g6957 | g6957.t39 | cds | g6957.t39.CDS1 | 20174642 | 20174887 |
| chr_2 | g6957 | g6957.t39 | exon | g6957.t39.exon2 | 20175915 | 20176147 |
| chr_2 | g6957 | g6957.t39 | cds | g6957.t39.CDS2 | 20175915 | 20176147 |
| chr_2 | g6957 | g6957.t39 | exon | g6957.t39.exon3 | 20176211 | 20176411 |
| chr_2 | g6957 | g6957.t39 | cds | g6957.t39.CDS3 | 20176211 | 20176411 |
| chr_2 | g6957 | g6957.t39 | exon | g6957.t39.exon4 | 20176888 | 20177053 |
| chr_2 | g6957 | g6957.t39 | cds | g6957.t39.CDS4 | 20176888 | 20177053 |
| chr_2 | g6957 | g6957.t39 | TSS | g6957.t39 | 20177133 | 20177133 |
>g6957.t39 Gene=g6957 Length=846
ATGGGAGGCAAAGCTAAAGATCCAATGTCCTTTGCTAAGGATTTTCTCGCTGGTGGTATC
TCAGCTGCTGTCTCAAAAACAGCTGTTGCTCCAATTGAACGTGTCAAATTGATTCTTCAA
GTACAAGCCGCTAACAAGCAAGTCGTTGCTGGAAAGGAATACAAAGGTATCATCGATTGC
TTCGTCCGTATTCCAAAAGAACAAGGTGTTGCTGCTTTCTGGCGTGGTAACTTGGCTAAT
GTCATCAGATATTTCCCAACTCAGGCCCTTAACTTCGCTTTTAAGGATGTCTACAAACAA
ATTTTCTTGGGTGGTGTTGATCAAAAGACACAATTCTGGCGTTACTTCTTTGGTAACTTG
GGTTCAGTGGGCGCTGATGTTGGTAAAGGAACAGCAGACCGTCAATACACTGGTCTTGTT
GATTGCATCAAGAAGACAATGAAATCAGACGGTGTCATTGGATTGTATCGTGGTTTCAAC
GTTTCAGTACAAGGTATTATCATTTACCGTGCTGCATACTTCGGTTGCTATGACACAGCT
CGTGGATCATTGCCTGATCCAAAGAATTCACCATTCATTGTCAACTTTGCTATTGCTCAG
GTTGTCACAATTTCGTCTGGTATCTTGTCATATCCATTCGACACTGTCAGACGGCGTATG
ATGATGCAGTCAGGTCGTGCTAAGGAAGATGTTATGTACAAGAACACATTGGACTGTTGG
GTTAAAATCTCCAAACAAGAAGGACCAAAAGCCTTCTTCAAGGGTGCATTGTCAAACGTT
TTCCGTGGTACTGGTGGTGCACTTGTATTGGTCTTCTACGACGAACTTAAGAAGCTCATT
GCCTAA
>g6957.t39 Gene=g6957 Length=281
MGGKAKDPMSFAKDFLAGGISAAVSKTAVAPIERVKLILQVQAANKQVVAGKEYKGIIDC
FVRIPKEQGVAAFWRGNLANVIRYFPTQALNFAFKDVYKQIFLGGVDQKTQFWRYFFGNL
GSVGADVGKGTADRQYTGLVDCIKKTMKSDGVIGLYRGFNVSVQGIIIYRAAYFGCYDTA
RGSLPDPKNSPFIVNFAIAQVVTISSGILSYPFDTVRRRMMMQSGRAKEDVMYKNTLDCW
VKISKQEGPKAFFKGALSNVFRGTGGALVLVFYDELKKLIA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 18 | g6957.t39 | Gene3D | G3DSA:1.50.40.10 | Mitochondrial carrier domain | 6 | 123 | 1.4E-40 |
| 19 | g6957.t39 | Gene3D | G3DSA:1.50.40.10 | Mitochondrial carrier domain | 124 | 280 | 9.5E-55 |
| 4 | g6957.t39 | PANTHER | PTHR45635 | ADP,ATP CARRIER PROTEIN 1-RELATED-RELATED | 8 | 125 | 3.3E-135 |
| 6 | g6957.t39 | PANTHER | PTHR45635:SF32 | ADP/ATP TRANSLOCASE 1 | 8 | 125 | 3.3E-135 |
| 5 | g6957.t39 | PANTHER | PTHR45635 | ADP,ATP CARRIER PROTEIN 1-RELATED-RELATED | 123 | 280 | 3.3E-135 |
| 7 | g6957.t39 | PANTHER | PTHR45635:SF32 | ADP/ATP TRANSLOCASE 1 | 123 | 280 | 3.3E-135 |
| 9 | g6957.t39 | PRINTS | PR00927 | Adenine nucleotide translocator signature | 11 | 23 | 2.1E-33 |
| 15 | g6957.t39 | PRINTS | PR00926 | Mitochondrial carrier protein signature | 14 | 27 | 4.6E-43 |
| 16 | g6957.t39 | PRINTS | PR00926 | Mitochondrial carrier protein signature | 27 | 41 | 4.6E-43 |
| 12 | g6957.t39 | PRINTS | PR00927 | Adenine nucleotide translocator signature | 54 | 75 | 2.1E-33 |
| 13 | g6957.t39 | PRINTS | PR00926 | Mitochondrial carrier protein signature | 76 | 96 | 4.6E-43 |
| 8 | g6957.t39 | PRINTS | PR00927 | Adenine nucleotide translocator signature | 87 | 99 | 2.1E-33 |
| 11 | g6957.t39 | PRINTS | PR00927 | Adenine nucleotide translocator signature | 114 | 127 | 2.1E-33 |
| 10 | g6957.t39 | PRINTS | PR00927 | Adenine nucleotide translocator signature | 195 | 211 | 2.1E-33 |
| 14 | g6957.t39 | PRINTS | PR00926 | Mitochondrial carrier protein signature | 199 | 221 | 4.6E-43 |
| 3 | g6957.t39 | Pfam | PF00153 | Mitochondrial carrier protein | 9 | 103 | 1.6E-24 |
| 2 | g6957.t39 | Pfam | PF00153 | Mitochondrial carrier protein | 131 | 182 | 2.3E-12 |
| 1 | g6957.t39 | Pfam | PF00153 | Mitochondrial carrier protein | 190 | 280 | 1.4E-16 |
| 21 | g6957.t39 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 153 | - |
| 23 | g6957.t39 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 154 | 172 | - |
| 22 | g6957.t39 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 173 | 191 | - |
| 24 | g6957.t39 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 192 | 213 | - |
| 20 | g6957.t39 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 214 | 281 | - |
| 29 | g6957.t39 | ProSiteProfiles | PS50920 | Solute carrier (Solcar) repeat profile. | 9 | 101 | 27.769 |
| 28 | g6957.t39 | ProSiteProfiles | PS50920 | Solute carrier (Solcar) repeat profile. | 109 | 183 | 14.854 |
| 27 | g6957.t39 | ProSiteProfiles | PS50920 | Solute carrier (Solcar) repeat profile. | 190 | 279 | 23.972 |
| 17 | g6957.t39 | SUPERFAMILY | SSF103506 | Mitochondrial carrier | 7 | 275 | 5.1E-72 |
| 26 | g6957.t39 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 154 | 176 | - |
| 25 | g6957.t39 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 213 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0140021 | mitochondrial ADP transmembrane transport | BP |
| GO:1990544 | mitochondrial ATP transmembrane transport | BP |
| GO:0055085 | transmembrane transport | BP |
| GO:0005471 | ATP:ADP antiporter activity | MF |
| GO:0005743 | mitochondrial inner membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.