General information for g6971.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Calcium release-activated calcium channel protein 1.
Parent gene
- The parent gene g6971 is located on chr_2: 20232593..20233719 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6971 | g6971.t1 | isoform | g6971.t1 | 20231243 | 20233090 |
| chr_2 | g6971 | g6971.t1 | TTS | g6971.t1 | 20231243 | 20231243 |
| chr_2 | g6971 | g6971.t1 | exon | g6971.t1.exon1 | 20231243 | 20231424 |
| chr_2 | g6971 | g6971.t1 | cds | g6971.t1.CDS1 | 20231243 | 20231424 |
| chr_2 | g6971 | g6971.t1 | exon | g6971.t1.exon2 | 20231489 | 20231646 |
| chr_2 | g6971 | g6971.t1 | cds | g6971.t1.CDS2 | 20231489 | 20231646 |
| chr_2 | g6971 | g6971.t1 | exon | g6971.t1.exon3 | 20231709 | 20231914 |
| chr_2 | g6971 | g6971.t1 | cds | g6971.t1.CDS3 | 20231709 | 20231914 |
| chr_2 | g6971 | g6971.t1 | exon | g6971.t1.exon4 | 20232572 | 20233090 |
| chr_2 | g6971 | g6971.t1 | cds | g6971.t1.CDS4 | 20232572 | 20233090 |
| chr_2 | g6971 | g6971.t1 | TSS | g6971.t1 | 20233719 | 20233719 |
Sequences
>g6971.t1 Gene=g6971 Length=1065
ATGATGCACTTAAGACGATGCTCAGAATCAGATTTGTGTTTGAATAAATTACTTCAGCCA
AGCAGCGCACAAACACCAGTATCTTCTTCGGATGGCGATAATGCAAGCGAAGCGCCGACT
AAATCTGATCGCTTGCTCATCGAAATAGATGAGAATACTGAAAATAGTCGCGATAATTAT
CTCTTACCAGTCACATCGCCAACTTCGAGTGCAAGAATAATTCCCGCGTCTCGACCACCG
CCTTCTGTAGCATCTTCGAGCGCACAGCGAAAAATTAAATATCAACTCGAGAACGATAAT
TTGTTATTGTTTAATAAATTTTTTAATCGGACAAATTCAAATTATTCTCATCCAATATCT
ACACAGCGTCGATCAGGTTTGAGCTCAGGACTTATCATGTCACAAGTTGCTGACGAATTT
CACACACCTAATTATCTCTCATGGAGGAAATTACAATTAAGTAGGGCTAAATTAAAAGCA
TCAAGTAAAACATCAGCGCTGTTATCTGGATTTGCTATGGTAGCCATGGTAGAAGTTCAA
TTAAACAATGATACACAAGTTCCCCTCGGTATGCTAATAGCATTCTCTGTTTGTACCACA
CTACTAGTAGCTGTTCATATGCTCGCACTTATGATTAGTACCTGCATTCTTCCAAATATT
GAGACTGTATGCAATCTACATAGTATATCACTTGTTCATGAATCGCCGCACGAGCGACTC
CATTGGTATATCGAGATAGCGTGGGCATTCTCAACATTAATAGGTTTAGTTTTATTTCTA
ATAGAAATTGCAATATTATGTTGGGTGAAATTTTATGACTTATCGCAAGCAGCTGCTTGG
TCTGCTTGTATTGTACTTGTTCCTGTACTTATAGTATTTTTAGCCTTCGCAATTCATTTT
TATCGCAGTCTCATGTCGCACAAGTATGAAGTCTCGGTATCAGGCATTCGAGAATTAGAA
ATGCTGCGTGAGCAAATCGAACAAGATAATCAAGTTCAAGATCAACATCGGAGACGTAAT
GCAAATGGTCTTAATTACTCCGCTGCAGGAACTGAAATTGTATAG
>g6971.t1 Gene=g6971 Length=354
MMHLRRCSESDLCLNKLLQPSSAQTPVSSSDGDNASEAPTKSDRLLIEIDENTENSRDNY
LLPVTSPTSSARIIPASRPPPSVASSSAQRKIKYQLENDNLLLFNKFFNRTNSNYSHPIS
TQRRSGLSSGLIMSQVADEFHTPNYLSWRKLQLSRAKLKASSKTSALLSGFAMVAMVEVQ
LNNDTQVPLGMLIAFSVCTTLLVAVHMLALMISTCILPNIETVCNLHSISLVHESPHERL
HWYIEIAWAFSTLIGLVLFLIEIAILCWVKFYDLSQAAAWSACIVLVPVLIVFLAFAIHF
YRSLMSHKYEVSVSGIRELEMLREQIEQDNQVQDQHRRRNANGLNYSAAGTEIV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g6971.t1 | Coils | Coil | Coil | 319 | 339 | - |
| 5 | g6971.t1 | Gene3D | G3DSA:1.20.140.140 | - | 133 | 346 | 1.1E-102 |
| 20 | g6971.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 21 | 36 | - |
| 21 | g6971.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 21 | 45 | - |
| 2 | g6971.t1 | PANTHER | PTHR31501:SF7 | CALCIUM RELEASE-ACTIVATED CALCIUM CHANNEL PROTEIN 1 | 111 | 334 | 3.4E-115 |
| 3 | g6971.t1 | PANTHER | PTHR31501 | CALCIUM RELEASE-ACTIVATED CALCIUM CHANNEL PROTEIN 1 | 111 | 334 | 3.4E-115 |
| 1 | g6971.t1 | Pfam | PF07856 | Mediator of CRAC channel activity | 145 | 310 | 9.7E-69 |
| 9 | g6971.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 159 | - |
| 12 | g6971.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 160 | 177 | - |
| 11 | g6971.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 178 | 188 | - |
| 15 | g6971.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 189 | 212 | - |
| 7 | g6971.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 213 | 245 | - |
| 14 | g6971.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 246 | 271 | - |
| 10 | g6971.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 272 | 276 | - |
| 13 | g6971.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 277 | 301 | - |
| 8 | g6971.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 302 | 354 | - |
| 4 | g6971.t1 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 23 | - |
| 19 | g6971.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 164 | 181 | - |
| 17 | g6971.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 213 | - |
| 18 | g6971.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 246 | 268 | - |
| 16 | g6971.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 278 | 300 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K16056 (calcium release-activated calcium channel protein 1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
