| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g703 | g703.t2 | TTS | g703.t2 | 5437966 | 5437966 |
| chr_3 | g703 | g703.t2 | isoform | g703.t2 | 5438031 | 5438517 |
| chr_3 | g703 | g703.t2 | exon | g703.t2.exon1 | 5438031 | 5438517 |
| chr_3 | g703 | g703.t2 | cds | g703.t2.CDS1 | 5438031 | 5438339 |
| chr_3 | g703 | g703.t2 | TSS | g703.t2 | 5438741 | 5438741 |
>g703.t2 Gene=g703 Length=487
AAATTTTTGCAACCGTGCAACAATCTTCAATCCAGCTCAATTAAGTTCTGCTCGTTATGT
ATCGATCAAAGTAGTTCCAGCAACTCAACCAGCTGTAGAGGGACATGATGCACGAAACGC
TAGATTTAAGCGTCCTCAATCACCACATCTTACCATTTATAAGCCTCAATTGACATCTAT
GCTTTCAATCACTCATCGTGGAACAGGCATTTTATTGTCATCTTATGTGATTGCAGCTGG
AATTGCCGGTATTTCAGGAGACTTTTCCGTTGTTTCATCAATTGAAGCTTTGCAACTTGG
CGCCGCATCGTTAGCAGCACTTAAATTCAGCATTGCTTTTCCATTTTCTTATCATCTTGT
CAATGGTATTCGTCATTTGTTTTGGGATATGGGAAAATTCTTGAGTATTAAAGAAGTCTA
TACTACTGGATATGCTATGCTTTTTGCATCAATTGTTCTTTCTTTGGCACTTACGTTTTT
GTTTTAA
>g703.t2 Gene=g703 Length=102
MLSITHRGTGILLSSYVIAAGIAGISGDFSVVSSIEALQLGAASLAALKFSIAFPFSYHL
VNGIRHLFWDMGKFLSIKEVYTTGYAMLFASIVLSLALTFLF
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g703.t2 | CDD | cd03499 | SQR_TypeC_SdhC | 1 | 100 | 1.84992E-19 |
| 4 | g703.t2 | Gene3D | G3DSA:1.20.1300.10 | Fumarate reductase respiratory complex transmembrane subunits | 1 | 100 | 5.2E-30 |
| 2 | g703.t2 | PANTHER | PTHR10978 | SUCCINATE DEHYDROGENASE CYTOCHROME B560 SUBUNIT | 1 | 100 | 4.6E-23 |
| 12 | g703.t2 | PIRSF | PIRSF000178 | SDH_cyt_b560 | 1 | 102 | 5.3E-27 |
| 1 | g703.t2 | Pfam | PF01127 | Succinate dehydrogenase/Fumarate reductase transmembrane subunit | 1 | 98 | 2.8E-15 |
| 5 | g703.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 11 | g703.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 32 | - |
| 7 | g703.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 33 | 37 | - |
| 10 | g703.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 38 | 61 | - |
| 6 | g703.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 62 | 81 | - |
| 9 | g703.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 82 | 101 | - |
| 8 | g703.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 102 | 102 | - |
| 17 | g703.t2 | ProSitePatterns | PS01001 | Succinate dehydrogenase cytochrome b subunit signature 2. | 59 | 72 | - |
| 3 | g703.t2 | SUPERFAMILY | SSF81343 | Fumarate reductase respiratory complex transmembrane subunits | 2 | 100 | 2.01E-17 |
| 18 | g703.t2 | TIGRFAM | TIGR02970 | succ_dehyd_cytB: succinate dehydrogenase, cytochrome b556 subunit | 2 | 100 | 8.8E-16 |
| 16 | g703.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 10 | 32 | - |
| 15 | g703.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 37 | 59 | - |
| 14 | g703.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 101 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016627 | oxidoreductase activity, acting on the CH-CH group of donors | MF |
| GO:0016020 | membrane | CC |
| GO:0009055 | electron transfer activity | MF |
| GO:0006099 | tricarboxylic acid cycle | BP |
| GO:0045281 | succinate dehydrogenase complex | CC |
| GO:0000104 | succinate dehydrogenase activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.