General information for g7077.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g7077 is located on chr_2: 21056545..21057036 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7077 | g7077.t1 | TSS | g7077.t1 | 21056422 | 21056422 |
| chr_2 | g7077 | g7077.t1 | isoform | g7077.t1 | 21056545 | 21057036 |
| chr_2 | g7077 | g7077.t1 | exon | g7077.t1.exon1 | 21056545 | 21056647 |
| chr_2 | g7077 | g7077.t1 | cds | g7077.t1.CDS1 | 21056545 | 21056647 |
| chr_2 | g7077 | g7077.t1 | exon | g7077.t1.exon2 | 21056849 | 21057036 |
| chr_2 | g7077 | g7077.t1 | cds | g7077.t1.CDS2 | 21056849 | 21057036 |
| chr_2 | g7077 | g7077.t1 | TTS | g7077.t1 | 21057100 | 21057100 |
Sequences
>g7077.t1 Gene=g7077 Length=291
ATGTCTAAGTTAGTGTCTTGTGAGTTTGAAGTGTTTGGAAAAGTACAGGGCGTTTATTTT
CGAAAGTACACGGAGAAACAGGCAATTATCTTGGGTTTAAGAGGTTGGTGCATGAATACT
GAAAATAATTCAGTAAAGGGACGTCTTGAAGGAGATAAAGAAAGAATTATGCTGATGCGT
GAATGGCTGAAAACAACTGGCAGTCCAAAATCTAATGTTGAACGAGCCTGTTTTACTGAA
TGTAGACCAATTCGAGAATTTACAGTCAGAAAATTTTCCATCAAACGATAA
>g7077.t1 Gene=g7077 Length=96
MSKLVSCEFEVFGKVQGVYFRKYTEKQAIILGLRGWCMNTENNSVKGRLEGDKERIMLMR
EWLKTTGSPKSNVERACFTECRPIREFTVRKFSIKR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g7077.t1 | Gene3D | G3DSA:3.30.70.100 | - | 1 | 96 | 1.2E-33 |
| 2 | g7077.t1 | PANTHER | PTHR10029 | ACYLPHOSPHATASE | 2 | 96 | 3.4E-32 |
| 3 | g7077.t1 | PANTHER | PTHR10029:SF3 | ACYLPHOSPHATASE-1 | 2 | 96 | 3.4E-32 |
| 5 | g7077.t1 | PRINTS | PR00112 | Acylphosphatase signature | 6 | 21 | 4.3E-17 |
| 6 | g7077.t1 | PRINTS | PR00112 | Acylphosphatase signature | 27 | 52 | 4.3E-17 |
| 4 | g7077.t1 | PRINTS | PR00112 | Acylphosphatase signature | 62 | 82 | 4.3E-17 |
| 1 | g7077.t1 | Pfam | PF00708 | Acylphosphatase | 7 | 94 | 4.0E-22 |
| 8 | g7077.t1 | ProSitePatterns | PS00150 | Acylphosphatase signature 1. | 11 | 21 | - |
| 10 | g7077.t1 | ProSiteProfiles | PS51160 | Acylphosphatase-like domain profile. | 6 | 96 | 27.523 |
| 7 | g7077.t1 | SUPERFAMILY | SSF54975 | Acylphosphatase/BLUF domain-like | 3 | 95 | 3.92E-24 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003998 | acylphosphatase activity | MF |
KEGG
Orthology
- This transcript has been annotated with K01512 (acylphosphatase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed