General information for g7115.t106
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative 40S ribosomal protein S9.
Parent gene
- The parent gene g7115 is located on chr_2: 21264902..21266725 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7115 | g7115.t106 | TTS | g7115.t106 | 21263047 | 21263047 |
| chr_2 | g7115 | g7115.t106 | isoform | g7115.t106 | 21263156 | 21264425 |
| chr_2 | g7115 | g7115.t106 | exon | g7115.t106.exon1 | 21263156 | 21263272 |
| chr_2 | g7115 | g7115.t106 | cds | g7115.t106.CDS1 | 21263268 | 21263272 |
| chr_2 | g7115 | g7115.t106 | exon | g7115.t106.exon2 | 21263773 | 21263831 |
| chr_2 | g7115 | g7115.t106 | cds | g7115.t106.CDS2 | 21263773 | 21263831 |
| chr_2 | g7115 | g7115.t106 | exon | g7115.t106.exon3 | 21264028 | 21264115 |
| chr_2 | g7115 | g7115.t106 | cds | g7115.t106.CDS3 | 21264028 | 21264115 |
| chr_2 | g7115 | g7115.t106 | exon | g7115.t106.exon4 | 21264227 | 21264425 |
| chr_2 | g7115 | g7115.t106 | cds | g7115.t106.CDS4 | 21264227 | 21264425 |
| chr_2 | g7115 | g7115.t106 | TSS | g7115.t106 | 21264887 | 21264887 |
Sequences
>g7115.t106 Gene=g7115 Length=463
AGAATTCCATCTGTGTTTTCGAAAACATATGTTACTCCTAGACGTCCATATGAAAAACCT
CGCTTGGATGCTGAATTAAGAGTTATCGGACAATTTGGTCTCCGTAACAAGCGTGAGGTA
TGGCGAGTCAAGTATACATTAGCAAAGATCCGTAAAGCTGCTCGTGAATTGCTTACACTT
GAAGAGAAAGATGAGAAACAACGTCGCTTGCAGACTCAAGTTTTCAAACTCGGTTTGGCT
AAATCTTATCATCATGCTCGCGTTCTTATCCGACAAAGACATATTCGCGTTCGTAAACAA
GTCGTCAACATCCCATCATTTGTCGTTCGTTTGGACTCGCAGAAACATTGATTTCTCATT
GAAGTCACCATTCGGTGGTGGACGACCAGGTCGCGTCAAGCGAAAGAATATGAAGAAGGG
TCAAGGTGGTAGCGGTGGCGCTGATGAAGAAGAAGAGGATTAA
>g7115.t106 Gene=g7115 Length=116
RIPSVFSKTYVTPRRPYEKPRLDAELRVIGQFGLRNKREVWRVKYTLAKIRKAARELLTL
EEKDEKQRRLQTQVFKLGLAKSYHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g7115.t106 | CDD | cd00165 | S4 | 68 | 110 | 4.4e-06 |
| 7 | g7115.t106 | Gene3D | G3DSA:3.10.290.10 | - | 69 | 114 | 0.0e+00 |
| 3 | g7115.t106 | PANTHER | PTHR11831:SF23 | 40S RIBOSOMAL PROTEIN S9 | 6 | 63 | 0.0e+00 |
| 5 | g7115.t106 | PANTHER | PTHR11831 | 30S 40S RIBOSOMAL PROTEIN | 6 | 63 | 0.0e+00 |
| 2 | g7115.t106 | PANTHER | PTHR11831:SF23 | 40S RIBOSOMAL PROTEIN S9 | 62 | 116 | 0.0e+00 |
| 4 | g7115.t106 | PANTHER | PTHR11831 | 30S 40S RIBOSOMAL PROTEIN | 62 | 116 | 0.0e+00 |
| 1 | g7115.t106 | Pfam | PF01479 | S4 domain | 68 | 111 | 0.0e+00 |
| 6 | g7115.t106 | SUPERFAMILY | SSF55174 | Alpha-L RNA-binding motif | 8 | 111 | 0.0e+00 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003723 | RNA binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed