Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative 40S ribosomal protein S9.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g7115 g7115.t86 TTS g7115.t86 21263047 21263047
chr_2 g7115 g7115.t86 isoform g7115.t86 21263156 21264308
chr_2 g7115 g7115.t86 exon g7115.t86.exon1 21263156 21263269
chr_2 g7115 g7115.t86 cds g7115.t86.CDS1 21263187 21263269
chr_2 g7115 g7115.t86 exon g7115.t86.exon2 21263773 21263831
chr_2 g7115 g7115.t86 cds g7115.t86.CDS2 21263773 21263831
chr_2 g7115 g7115.t86 exon g7115.t86.exon3 21264028 21264308
chr_2 g7115 g7115.t86 cds g7115.t86.CDS3 21264028 21264161
chr_2 g7115 g7115.t86 TSS g7115.t86 21264887 21264887

Sequences

>g7115.t86 Gene=g7115 Length=454
GTATGGCGAGTCAAGTATACATTAGCAAAGATCCGTAAAGCTGCTCGTGAATTGCTTACA
CTTGAAGAGAAAGATGAGAAACGTTTGTTTCAAGGAAATGCTCTTCTTCGTCGTCTTGTT
CGTATTGGTGTGTTAGACGAATCACGCATGAAGCTCGATTACGTTCTTGGTTTAAAAATT
GAAGATTTCTTAGAACGTCGCTTGCAGACTCAAGTTTTCAAACTCGGTTTGGCTAAATCT
TATCATCATGCTCGCGTTCTTATCCGACAAAGACATATTCGCGTTCGTAAACAAGTCGTC
AACATCCCATCATTTGTCGTTCGTTTGGACTCGCAGAAACGATTTCTCATTGAAGTCACC
ATTCGGTGGTGGACGACCAGGTCGCGTCAAGCGAAAGAATATGAAGAAGGGTCAAGGTGG
TAGCGGTGGCGCTGATGAAGAAGAAGAGGATTAA

>g7115.t86 Gene=g7115 Length=91
MKLDYVLGLKIEDFLERRLQTQVFKLGLAKSYHHARVLIRQRHIRVRKQVVNIPSFVVRL
DSQKRFLIEVTIRWWTTRSRQAKEYEEGSRW

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g7115.t86 CDD cd00165 S4 17 59 7.72843E-7
5 g7115.t86 Gene3D G3DSA:3.10.290.10 - 16 87 1.9E-11
2 g7115.t86 PANTHER PTHR11831:SF23 40S RIBOSOMAL PROTEIN S9 1 84 4.4E-36
3 g7115.t86 PANTHER PTHR11831 30S 40S RIBOSOMAL PROTEIN 1 84 4.4E-36
1 g7115.t86 Pfam PF01479 S4 domain 17 60 6.1E-10
7 g7115.t86 ProSitePatterns PS00632 Ribosomal protein S4 signature. 15 39 -
10 g7115.t86 ProSiteProfiles PS50889 S4 RNA-binding domain profile. 17 88 9.138
8 g7115.t86 SMART SM00363 s4_6 17 87 0.0048
4 g7115.t86 SUPERFAMILY SSF55174 Alpha-L RNA-binding motif 2 61 3.93E-18
9 g7115.t86 TIGRFAM TIGR01018 uS4_arch: ribosomal protein uS4 1 65 4.0E-29

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0003723 RNA binding MF
GO:0006412 translation BP
GO:0003735 structural constituent of ribosome MF
GO:0015935 small ribosomal subunit CC
GO:0019843 rRNA binding MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed