| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7115 | g7115.t87 | TTS | g7115.t87 | 21263047 | 21263047 |
| chr_2 | g7115 | g7115.t87 | isoform | g7115.t87 | 21263156 | 21264308 |
| chr_2 | g7115 | g7115.t87 | exon | g7115.t87.exon1 | 21263156 | 21263272 |
| chr_2 | g7115 | g7115.t87 | cds | g7115.t87.CDS1 | 21263156 | 21263272 |
| chr_2 | g7115 | g7115.t87 | exon | g7115.t87.exon2 | 21263768 | 21263831 |
| chr_2 | g7115 | g7115.t87 | cds | g7115.t87.CDS2 | 21263768 | 21263831 |
| chr_2 | g7115 | g7115.t87 | exon | g7115.t87.exon3 | 21264028 | 21264308 |
| chr_2 | g7115 | g7115.t87 | cds | g7115.t87.CDS3 | 21264028 | 21264161 |
| chr_2 | g7115 | g7115.t87 | TSS | g7115.t87 | 21264887 | 21264887 |
>g7115.t87 Gene=g7115 Length=462
GTATGGCGAGTCAAGTATACATTAGCAAAGATCCGTAAAGCTGCTCGTGAATTGCTTACA
CTTGAAGAGAAAGATGAGAAACGTTTGTTTCAAGGAAATGCTCTTCTTCGTCGTCTTGTT
CGTATTGGTGTGTTAGACGAATCACGCATGAAGCTCGATTACGTTCTTGGTTTAAAAATT
GAAGATTTCTTAGAACGTCGCTTGCAGACTCAAGTTTTCAAACTCGGTTTGGCTAAATCT
TATCATCATGCTCGCGTTCTTATCCGACAAAGACATATTCGCGTTCGTAAACAAGTCGTC
AACATCCCATCATTTGTCGTTCGTTTGGACTCGCAGAAACNNNNNATTGATTTCTCATTG
AAGTCACCATTCGGTGGTGGACGACCAGGTCGCGTCAAGCGAAAGAATATGAAGAAGGGT
CAAGGTGGTAGCGGTGGCGCTGATGAAGAAGAAGAGGATTAA
>g7115.t87 Gene=g7115 Length=104
MKLDYVLGLKIEDFLERRLQTQVFKLGLAKSYHHARVLIRQRHIRVRKQVVNIPSFVVRL
DSQKXXIDFSLKSPFGGGRPGRVKRKNMKKGQGGSGGADEEEED
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g7115.t87 | CDD | cd00165 | S4 | 17 | 59 | 5.64734E-7 |
| 5 | g7115.t87 | Gene3D | G3DSA:3.10.290.10 | - | 16 | 77 | 2.3E-11 |
| 8 | g7115.t87 | MobiDBLite | mobidb-lite | consensus disorder prediction | 78 | 104 | - |
| 2 | g7115.t87 | PANTHER | PTHR11831:SF27 | - | 2 | 104 | 1.5E-53 |
| 3 | g7115.t87 | PANTHER | PTHR11831 | 30S 40S RIBOSOMAL PROTEIN | 2 | 104 | 1.5E-53 |
| 1 | g7115.t87 | Pfam | PF01479 | S4 domain | 17 | 60 | 8.4E-10 |
| 7 | g7115.t87 | ProSitePatterns | PS00632 | Ribosomal protein S4 signature. | 15 | 39 | - |
| 10 | g7115.t87 | ProSiteProfiles | PS50889 | S4 RNA-binding domain profile. | 17 | 92 | 9.321 |
| 4 | g7115.t87 | SUPERFAMILY | SSF55174 | Alpha-L RNA-binding motif | 2 | 61 | 4.84E-18 |
| 9 | g7115.t87 | TIGRFAM | TIGR01018 | uS4_arch: ribosomal protein uS4 | 1 | 75 | 3.9E-32 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003723 | RNA binding | MF |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
| GO:0015935 | small ribosomal subunit | CC |
| GO:0019843 | rRNA binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed