General information for g7122.t18
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g7122 is located on chr_2: 21344827..21345609 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7122 | g7122.t18 | isoform | g7122.t18 | 21344827 | 21345474 |
| chr_2 | g7122 | g7122.t18 | exon | g7122.t18.exon1 | 21344827 | 21344877 |
| chr_2 | g7122 | g7122.t18 | cds | g7122.t18.CDS1 | 21344828 | 21344877 |
| chr_2 | g7122 | g7122.t18 | exon | g7122.t18.exon2 | 21344950 | 21345139 |
| chr_2 | g7122 | g7122.t18 | cds | g7122.t18.CDS2 | 21344950 | 21345139 |
| chr_2 | g7122 | g7122.t18 | exon | g7122.t18.exon3 | 21345415 | 21345474 |
| chr_2 | g7122 | g7122.t18 | cds | g7122.t18.CDS3 | 21345415 | 21345474 |
| chr_2 | g7122 | g7122.t18 | TSS | g7122.t18 | 21345607 | 21345607 |
| chr_2 | g7122 | g7122.t18 | TTS | g7122.t18 | NA | NA |
Sequences
>g7122.t18 Gene=g7122 Length=301
ATGTACGCAAAATCTAATGGAACAAATGGCACGAATCTTTCAGAAGTTATCGGAAGTCCT
CCAAAGTTGAAGGAAGGCGGATCGTACATTATGGAGTCACATTCCTCATCAAGTTCTGGA
AAAACAATTATAATATTTTCACCAACTGATCAAAGCAGTGCCGGTAGCTTAGCAAAAGTG
CTTAAAATTTTCGACGTATTTAGTGTCGATCTTACTCATATCGAATCACGATCATCACTG
AGAGTTCCAGGCTATGAATTCATGGTCGAGTGCGACGTTCACAAAAATCCCCATTTACAC
G
>g7122.t18 Gene=g7122 Length=100
MYAKSNGTNGTNLSEVIGSPPKLKEGGSYIMESHSSSSSGKTIIIFSPTDQSSAGSLAKV
LKIFDVFSVDLTHIESRSSLRVPGYEFMVECDVHKNPHLH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g7122.t18 | Gene3D | G3DSA:3.30.70.260 | - | 26 | 99 | 3.4E-15 |
| 2 | g7122.t18 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 20 | - |
| 3 | g7122.t18 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 16 | - |
| 5 | g7122.t18 | ProSiteProfiles | PS51671 | ACT domain profile. | 45 | 100 | 8.596 |
| 1 | g7122.t18 | SUPERFAMILY | SSF55021 | ACT-like | 34 | 97 | 2.22E-11 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed