| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7122 | g7122.t3 | TTS | g7122.t3 | 21342968 | 21342968 |
| chr_2 | g7122 | g7122.t3 | isoform | g7122.t3 | 21343416 | 21344178 |
| chr_2 | g7122 | g7122.t3 | exon | g7122.t3.exon1 | 21343416 | 21343446 |
| chr_2 | g7122 | g7122.t3 | cds | g7122.t3.CDS1 | 21343416 | 21343446 |
| chr_2 | g7122 | g7122.t3 | exon | g7122.t3.exon2 | 21343500 | 21343652 |
| chr_2 | g7122 | g7122.t3 | cds | g7122.t3.CDS2 | 21343500 | 21343652 |
| chr_2 | g7122 | g7122.t3 | exon | g7122.t3.exon3 | 21343712 | 21344085 |
| chr_2 | g7122 | g7122.t3 | cds | g7122.t3.CDS3 | 21343712 | 21344049 |
| chr_2 | g7122 | g7122.t3 | exon | g7122.t3.exon4 | 21344164 | 21344178 |
| chr_2 | g7122 | g7122.t3 | TSS | g7122.t3 | NA | NA |
>g7122.t3 Gene=g7122 Length=573
CATCCAAGTAAGCCGTTATACACGCCTGAACCTGATGTTGTTCATGAATTGATGGGACAT
GCTCCACTTTTTGCTGATCCAGCATTTGCACAATTTTCACAAGAAATTGGTTTAGCATCA
CTTGGTGCACCTGATGATTATATTGAAAAATTAGCAACATGCTTTTGGTTTACAGTTGAG
TATGGCTTGTGTAGAGAAAATGGAAATCTCAAGGCATACGGTGCTGGTTTACTTTCGAGT
TACGGTGAATTAGAATATTGTTTGAGTGACAAACCACAAATCAAAGATTTTGAACCTGAA
GTAACTGGTTTACAAAAATATCCAATCACTGAGTATCAACCAATTTACTTTGTTGCTGAT
AGCTTCGACAATGCAAAGGATAAAATGATTAAATTTGCTGATACGATTCCTCGTCCATTT
GGAGTCCGCTACAACGCATACACTCAATCAATTGAAGTTCTCGATACAAAACCACAGCTG
AATAATTTGCTTTCGAATATCAATTTGGAGATGCATATATTGCAGAACGCATTACAAAAA
TTAATGATTGATCCAGAAGTGAAATGTCCATGA
>g7122.t3 Gene=g7122 Length=173
MGHAPLFADPAFAQFSQEIGLASLGAPDDYIEKLATCFWFTVEYGLCRENGNLKAYGAGL
LSSYGELEYCLSDKPQIKDFEPEVTGLQKYPITEYQPIYFVADSFDNAKDKMIKFADTIP
RPFGVRYNAYTQSIEVLDTKPQLNNLLSNINLEMHILQNALQKLMIDPEVKCP
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g7122.t3 | Coils | Coil | Coil | 147 | 167 | - |
| 8 | g7122.t3 | Gene3D | G3DSA:1.10.800.10 | Phenylalanine Hydroxylase | 1 | 165 | 2.9E-71 |
| 2 | g7122.t3 | PANTHER | PTHR11473 | AROMATIC AMINO ACID HYDROXYLASE | 1 | 164 | 2.6E-78 |
| 6 | g7122.t3 | PRINTS | PR00372 | Biopterin-dependent aromatic amino acid hydroxylase signature | 15 | 34 | 5.5E-42 |
| 3 | g7122.t3 | PRINTS | PR00372 | Biopterin-dependent aromatic amino acid hydroxylase signature | 55 | 73 | 5.5E-42 |
| 4 | g7122.t3 | PRINTS | PR00372 | Biopterin-dependent aromatic amino acid hydroxylase signature | 86 | 105 | 5.5E-42 |
| 5 | g7122.t3 | PRINTS | PR00372 | Biopterin-dependent aromatic amino acid hydroxylase signature | 121 | 139 | 5.5E-42 |
| 1 | g7122.t3 | Pfam | PF00351 | Biopterin-dependent aromatic amino acid hydroxylase | 1 | 162 | 1.6E-74 |
| 10 | g7122.t3 | ProSiteProfiles | PS51410 | Biopterin-dependent aromatic amino acid hydroxylase family profile. | 1 | 165 | 67.753 |
| 7 | g7122.t3 | SUPERFAMILY | SSF56534 | Aromatic aminoacid monoxygenases, catalytic and oligomerization domains | 1 | 164 | 9.29E-66 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0009072 | aromatic amino acid family metabolic process | BP |
| GO:0005506 | iron ion binding | MF |
| GO:0016714 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen | MF |
| GO:0004497 | monooxygenase activity | MF |
| GO:0055114 | NA | NA |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed