General information for g714.t5
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Elongation factor 1-gamma.
Parent gene
- The parent gene g714 is located on chr_3: 5473182..5479543 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g714 | g714.t5 | TTS | g714.t5 | 5471464 | 5471464 |
| chr_3 | g714 | g714.t5 | isoform | g714.t5 | 5471712 | 5472159 |
| chr_3 | g714 | g714.t5 | exon | g714.t5.exon1 | 5471712 | 5471756 |
| chr_3 | g714 | g714.t5 | cds | g714.t5.CDS1 | 5471713 | 5471756 |
| chr_3 | g714 | g714.t5 | exon | g714.t5.exon2 | 5471885 | 5472159 |
| chr_3 | g714 | g714.t5 | cds | g714.t5.CDS2 | 5471885 | 5472152 |
| chr_3 | g714 | g714.t5 | TSS | g714.t5 | NA | NA |
Sequences
>g714.t5 Gene=g714 Length=320
ATTCAATATGGACGACTTCAAGCGTGTATACAGTAATGAAGATGAAGCAAAATCAATTCC
ATATTTCTTCGAGAAATTCGATCCAGAAAATTACTCAATTTGGTATGGTGAATATAAATA
TCCAGAAGAATTGACTAAGGTATTTATGAGCTGCAATTTAATCACCGGTATGTTCCAACG
TCTTGATAAAATGAGAAAACAAGCATTTGCCTCATGCTGCCTCTTCGGTGAAGACAATAA
TAGCACAATTTCTGGTGTCTGGGTATGGCGTGGACGACAAAGGAGGCCGCAAATTCAATC
AAGGCAAAATTTTCAAATAA
>g714.t5 Gene=g714 Length=104
MDDFKRVYSNEDEAKSIPYFFEKFDPENYSIWYGEYKYPEELTKVFMSCNLITGMFQRLD
KMRKQAFASCCLFGEDNNSTISGVWVWRGRQRRPQIQSRQNFQI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g714.t5 | Gene3D | G3DSA:3.30.70.1010 | - | 1 | 104 | 0.000 |
| 2 | g714.t5 | PANTHER | PTHR43986:SF1 | ELONGATION FACTOR 1-GAMMA | 1 | 98 | 0.000 |
| 3 | g714.t5 | PANTHER | PTHR43986 | ELONGATION FACTOR 1-GAMMA | 1 | 98 | 0.000 |
| 1 | g714.t5 | Pfam | PF00647 | Elongation factor 1 gamma, conserved domain | 1 | 90 | 0.000 |
| 7 | g714.t5 | ProSiteProfiles | PS50040 | Elongation factor 1 (EF-1) gamma C-terminal domain profile. | 1 | 104 | 52.837 |
| 5 | g714.t5 | SMART | SM01183 | EF1G_2 | 1 | 91 | 0.000 |
| 4 | g714.t5 | SUPERFAMILY | SSF89942 | eEF1-gamma domain | 1 | 96 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003746 | translation elongation factor activity | MF |
| GO:0006414 | translational elongation | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed