| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7142 | g7142.t7 | TTS | g7142.t7 | 21478218 | 21478218 |
| chr_2 | g7142 | g7142.t7 | isoform | g7142.t7 | 21478817 | 21479817 |
| chr_2 | g7142 | g7142.t7 | exon | g7142.t7.exon1 | 21478817 | 21479125 |
| chr_2 | g7142 | g7142.t7 | cds | g7142.t7.CDS1 | 21478817 | 21479125 |
| chr_2 | g7142 | g7142.t7 | exon | g7142.t7.exon2 | 21479653 | 21479817 |
| chr_2 | g7142 | g7142.t7 | TSS | g7142.t7 | 21480158 | 21480158 |
>g7142.t7 Gene=g7142 Length=474
TCTAATCAGTGAATACTGATGCTTAAGTTTTATAGCAAAATTAAAACATCTTTTTTATTT
GGTCACGAGCTTCAATACAAATTATATATTTTGCAACAACACATAATTTTTTAACAATTA
TATTTGGATAAAACAAGTTTGTTAAAATATATTATTGACACTGAGATGTCAACAACATCA
GATTTATCCGTCAATGAAACATTGCCTGATTCGACAGCCTCAATAGAGGAAGAACATGCT
TCTACAAGTGAAATTGATCAAACTCATCGATCTTCAACACAATATTCATTTACTCCAACA
GCTGAAAATAGCAAGACTTCTACAAAACCGGATGCTGCAAAAAAGGATGATGAAGATGAC
GAAGACAAACGGGATGACTCAATGTTTGTGTGTAATATTTGTTTAGATATTGCAAAAGAT
TCTGTAATTACTTTTTGTGGCCATTTATATTGTTGGCCTTGCATCAACTGTTGG
>g7142.t7 Gene=g7142 Length=103
MSTTSDLSVNETLPDSTASIEEEHASTSEIDQTHRSSTQYSFTPTAENSKTSTKPDAAKK
DDEDDEDKRDDSMFVCNICLDIAKDSVITFCGHLYCWPCINCW
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g7142.t7 | Gene3D | G3DSA:3.30.40.10 | Zinc/RING finger domain | 8 | 103 | 3.9E-11 |
| 8 | g7142.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 21 | - |
| 9 | g7142.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 69 | - |
| 7 | g7142.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 31 | 52 | - |
| 6 | g7142.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 53 | 69 | - |
| 2 | g7142.t7 | PANTHER | PTHR12313:SF71 | OS01G0830200 PROTEIN | 3 | 103 | 7.4E-20 |
| 3 | g7142.t7 | PANTHER | PTHR12313 | E3 UBIQUITIN-PROTEIN LIGASE RNF5-RELATED | 3 | 103 | 7.4E-20 |
| 1 | g7142.t7 | Pfam | PF00097 | Zinc finger, C3HC4 type (RING finger) | 76 | 101 | 2.8E-5 |
| 5 | g7142.t7 | ProSitePatterns | PS00518 | Zinc finger RING-type signature. | 91 | 100 | - |
| 11 | g7142.t7 | ProSiteProfiles | PS50089 | Zinc finger RING-type profile. | 76 | 103 | 8.713 |
| 4 | g7142.t7 | SUPERFAMILY | SSF57850 | RING/U-box | 75 | 103 | 1.19E-10 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0046872 | metal ion binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed