| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7148 | g7148.t1 | TSS | g7148.t1 | 21509081 | 21509081 |
| chr_2 | g7148 | g7148.t1 | isoform | g7148.t1 | 21509142 | 21509831 |
| chr_2 | g7148 | g7148.t1 | exon | g7148.t1.exon1 | 21509142 | 21509236 |
| chr_2 | g7148 | g7148.t1 | cds | g7148.t1.CDS1 | 21509142 | 21509236 |
| chr_2 | g7148 | g7148.t1 | exon | g7148.t1.exon2 | 21509342 | 21509429 |
| chr_2 | g7148 | g7148.t1 | cds | g7148.t1.CDS2 | 21509342 | 21509429 |
| chr_2 | g7148 | g7148.t1 | exon | g7148.t1.exon3 | 21509487 | 21509831 |
| chr_2 | g7148 | g7148.t1 | cds | g7148.t1.CDS3 | 21509487 | 21509831 |
| chr_2 | g7148 | g7148.t1 | TTS | g7148.t1 | 21510089 | 21510089 |
>g7148.t1 Gene=g7148 Length=528
ATGGCAAATCAAAATATTAATGTGGATCCTATATCTTTAACAAAGAACAGTCAAGAGGAG
ACCATTGGAAGTAAAGGAAGCGCAGTTGCTAAAAGACTACAAAAAGAATTAATGGCTTTA
ATGATGAGTTCAGAGAAGTCGGTTTCAGCATTCCCAGATAACTCGAATTTGTTCAAATGG
AAGGCAACAATAGTTGGGCCACAAGATACAGTCTATGAAAATCAAAAATATCGACTTTCG
ATCGAGTTTCCCAACAATTATCCTTACACTGCACCAAAGGTGGTCTTTTTAACCCCTTGT
TTTCATCCAAATATTGATCTTTCAACTGGTGCTTTGTGTCTGGATATATTAAAAGAAAAA
TGGAGTGCTCTATATGATGTTAGAACGATTCTTTTATCTATTCAATCATTACTTTCCGAA
CCTAATAATGAGAGTCCACTTAATACACAAGCCGCTGGATTATGGAAAAATCAAGAAGAG
TATAAAAAATATCTTCTTCAATTTTATGAAAAGAACAAAGATGTATGA
>g7148.t1 Gene=g7148 Length=175
MANQNINVDPISLTKNSQEETIGSKGSAVAKRLQKELMALMMSSEKSVSAFPDNSNLFKW
KATIVGPQDTVYENQKYRLSIEFPNNYPYTAPKVVFLTPCFHPNIDLSTGALCLDILKEK
WSALYDVRTILLSIQSLLSEPNNESPLNTQAAGLWKNQEEYKKYLLQFYEKNKDV
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g7148.t1 | CDD | cd00195 | UBCc | 31 | 169 | 4.93551E-63 |
| 5 | g7148.t1 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 21 | 174 | 1.0E-60 |
| 2 | g7148.t1 | PANTHER | PTHR24068:SF228 | UBIQUITIN-CONJUGATING ENZYME E2 20 | 23 | 171 | 4.5E-65 |
| 3 | g7148.t1 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 23 | 171 | 4.5E-65 |
| 1 | g7148.t1 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 32 | 164 | 2.7E-48 |
| 7 | g7148.t1 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 101 | 117 | - |
| 9 | g7148.t1 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 31 | 164 | 37.057 |
| 8 | g7148.t1 | SMART | SM00212 | ubc_7 | 31 | 174 | 1.8E-65 |
| 4 | g7148.t1 | SUPERFAMILY | SSF54495 | UBC-like | 23 | 170 | 2.88E-54 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.