General information for g7148.t9
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ubiquitin-conjugating enzyme E2 C.
Parent gene
- The parent gene g7148 is located on chr_2: 21509142..21510119 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7148 | g7148.t9 | TSS | g7148.t9 | 21509081 | 21509081 |
| chr_2 | g7148 | g7148.t9 | isoform | g7148.t9 | 21509142 | 21509831 |
| chr_2 | g7148 | g7148.t9 | exon | g7148.t9.exon1 | 21509142 | 21509225 |
| chr_2 | g7148 | g7148.t9 | exon | g7148.t9.exon2 | 21509353 | 21509429 |
| chr_2 | g7148 | g7148.t9 | cds | g7148.t9.CDS1 | 21509358 | 21509429 |
| chr_2 | g7148 | g7148.t9 | exon | g7148.t9.exon3 | 21509487 | 21509831 |
| chr_2 | g7148 | g7148.t9 | cds | g7148.t9.CDS2 | 21509487 | 21509831 |
| chr_2 | g7148 | g7148.t9 | TTS | g7148.t9 | 21510089 | 21510089 |
Sequences
>g7148.t9 Gene=g7148 Length=506
ATGGCAAATCAAAATATTAATGTGGATCCTATATCTTTAACAAAGAACAGTCAAGAGGAG
ACCATTGGAAGTAAAGGAAGCGCAAATTAATGGCTTTAATGATGAGTTCAGAGAAGTCGG
TTTCAGCATTCCCAGATAACTCGAATTTGTTCAAATGGAAGGCAACAATAGTTGGGCCAC
AAGATACAGTCTATGAAAATCAAAAATATCGACTTTCGATCGAGTTTCCCAACAATTATC
CTTACACTGCACCAAAGGTGGTCTTTTTAACCCCTTGTTTTCATCCAAATATTGATCTTT
CAACTGGTGCTTTGTGTCTGGATATATTAAAAGAAAAATGGAGTGCTCTATATGATGTTA
GAACGATTCTTTTATCTATTCAATCATTACTTTCCGAACCTAATAATGAGAGTCCACTTA
ATACACAAGCCGCTGGATTATGGAAAAATCAAGAAGAGTATAAAAAATATCTTCTTCAAT
TTTATGAAAAGAACAAAGATGTATGA
>g7148.t9 Gene=g7148 Length=138
MALMMSSEKSVSAFPDNSNLFKWKATIVGPQDTVYENQKYRLSIEFPNNYPYTAPKVVFL
TPCFHPNIDLSTGALCLDILKEKWSALYDVRTILLSIQSLLSEPNNESPLNTQAAGLWKN
QEEYKKYLLQFYEKNKDV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g7148.t9 | CDD | cd00195 | UBCc | 3 | 132 | 9.85667E-57 |
| 5 | g7148.t9 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 137 | 1.9E-55 |
| 2 | g7148.t9 | PANTHER | PTHR24068:SF228 | UBIQUITIN-CONJUGATING ENZYME E2 20 | 1 | 134 | 2.7E-59 |
| 3 | g7148.t9 | PANTHER | PTHR24068 | UBIQUITIN-CONJUGATING ENZYME E2 | 1 | 134 | 2.7E-59 |
| 1 | g7148.t9 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 5 | 127 | 3.4E-46 |
| 7 | g7148.t9 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 64 | 80 | - |
| 9 | g7148.t9 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 1 | 127 | 34.304 |
| 8 | g7148.t9 | SMART | SM00212 | ubc_7 | 1 | 137 | 6.9E-56 |
| 4 | g7148.t9 | SUPERFAMILY | SSF54495 | UBC-like | 3 | 133 | 7.74E-49 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K06688 (ubiquitin-conjugating enzyme E2 C)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed