Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g7199 g7199.t6 isoform g7199.t6 22054556 22059211
chr_2 g7199 g7199.t6 exon g7199.t6.exon1 22054556 22054633
chr_2 g7199 g7199.t6 cds g7199.t6.CDS1 22054558 22054633
chr_2 g7199 g7199.t6 TTS g7199.t6 22054564 22054564
chr_2 g7199 g7199.t6 exon g7199.t6.exon2 22055100 22055272
chr_2 g7199 g7199.t6 cds g7199.t6.CDS2 22055100 22055272
chr_2 g7199 g7199.t6 exon g7199.t6.exon3 22058697 22058825
chr_2 g7199 g7199.t6 cds g7199.t6.CDS3 22058697 22058825
chr_2 g7199 g7199.t6 exon g7199.t6.exon4 22059059 22059211
chr_2 g7199 g7199.t6 cds g7199.t6.CDS4 22059059 22059211
chr_2 g7199 g7199.t6 TSS g7199.t6 22059399 22059399

Sequences

>g7199.t6 Gene=g7199 Length=533
ATGACTGTGGAAGCAACTTCTTTTCTTTCTACATCCAAAATCTCCAACAGCCATGAAAAA
TCAGCAAAAATTTTAAAGAATCACAAGAATCTTATAATCATTTTGCTTGCATTCGTTTTA
TTGCTCTTTAGTGTTTTGGCATCCATTCTTCAGATTTACATATACAATGAATTAAATAAA
TCACAAGAAGAAATAGAGCAATTGAAGAAAGATATTCAAGAAATAAAAAATAATGAGCTC
GACCGTAAATTGATAACGGAGATCAATGCATTCAATCGAAAGTATCATAATCAAAATGAT
GTACAGGATCAAATAAATCTCGATGAGAAAGTAGATCTTATCGAGAATGATAAGGTTAAA
TTCGATGATGTTGGCGATGAAAATGATGAAGAAGAGGAAGAGTTAGATGAGCAATTTGAT
GAAAACGAAGATGATAATTATGAGGGATACCCAAGTGGTTATGGTGATGACGAATATGAT
GATGAATATGACTTGGATTCATTGGAAGATTCAGAAGATATACACAAAACAGA

>g7199.t6 Gene=g7199 Length=177
MTVEATSFLSTSKISNSHEKSAKILKNHKNLIIILLAFVLLLFSVLASILQIYIYNELNK
SQEEIEQLKKDIQEIKNNELDRKLITEINAFNRKYHNQNDVQDQINLDEKVDLIENDKVK
FDDVGDENDEEEEELDEQFDENEDDNYEGYPSGYGDDEYDDEYDLDSLEDSEDIHKT

Protein features from InterProScan

Transcript Database ID Name Start End E.value
4 g7199.t6 Coils Coil Coil 55 78 -
5 g7199.t6 Coils Coil Coil 121 148 -
2 g7199.t6 MobiDBLite mobidb-lite consensus disorder prediction 121 177 -
3 g7199.t6 MobiDBLite mobidb-lite consensus disorder prediction 124 168 -
6 g7199.t6 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 30 -
8 g7199.t6 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 31 55 -
7 g7199.t6 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 56 177 -
1 g7199.t6 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 31 53 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values