| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7303 | g7303.t31 | TTS | g7303.t31 | 22847929 | 22847929 |
| chr_2 | g7303 | g7303.t31 | isoform | g7303.t31 | 22848080 | 22849147 |
| chr_2 | g7303 | g7303.t31 | exon | g7303.t31.exon1 | 22848080 | 22848182 |
| chr_2 | g7303 | g7303.t31 | exon | g7303.t31.exon2 | 22848249 | 22848310 |
| chr_2 | g7303 | g7303.t31 | exon | g7303.t31.exon3 | 22848386 | 22848511 |
| chr_2 | g7303 | g7303.t31 | cds | g7303.t31.CDS1 | 22848448 | 22848511 |
| chr_2 | g7303 | g7303.t31 | exon | g7303.t31.exon4 | 22848617 | 22848675 |
| chr_2 | g7303 | g7303.t31 | cds | g7303.t31.CDS2 | 22848617 | 22848675 |
| chr_2 | g7303 | g7303.t31 | exon | g7303.t31.exon5 | 22848751 | 22848824 |
| chr_2 | g7303 | g7303.t31 | cds | g7303.t31.CDS3 | 22848751 | 22848824 |
| chr_2 | g7303 | g7303.t31 | exon | g7303.t31.exon6 | 22848955 | 22849009 |
| chr_2 | g7303 | g7303.t31 | cds | g7303.t31.CDS4 | 22848955 | 22849009 |
| chr_2 | g7303 | g7303.t31 | exon | g7303.t31.exon7 | 22849085 | 22849147 |
| chr_2 | g7303 | g7303.t31 | cds | g7303.t31.CDS5 | 22849085 | 22849147 |
| chr_2 | g7303 | g7303.t31 | TSS | g7303.t31 | 22849846 | 22849846 |
>g7303.t31 Gene=g7303 Length=542
ATGGGAAACGTATTTGCTAATCTGTTCAAAGGTTTATTTGGTAAAAAGGAGATGAGAATA
TTGATGGTTGGTCTCGATGCTGCTGGTAAAACGACAATTTTATACAAGCTTAAATTAGGT
GAAATTGTAACTACAATCCCAACCATTGGCTTCAACGTTGAAACTGTAGAATACAAAAAT
ATTTCATTTACTATGTTGGTGGTCAAGACAAAATCCGCCCACTCTGGAGACATTATTTCC
AAAATACCCAAGGGCTTATCTTTGTCGTTGATAGTAATGACCGTGAGCGTGTTGGTGAAG
CTCGTGAAGAATTAATGAGAATGTTGGCTGAAGATGAATTGAGGGATGCTGTGCTTTTAA
TTTTTGCCAACAAGCAGGATTTGCCCAATGCTATGAATGCAGCCGAAATCACAGATAAAT
TAGGTCTTCACTCATTACGAAACCGAAGCTGGTATATTCAAGCAACGTGTGCAACCAGTG
GAGATGGCCTCTATGAAGGTTTGGATTGGCTTTCGAATCAACTGAAGAACGCTAACCGCT
AA
>g7303.t31 Gene=g7303 Length=104
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTMLVVKTKSAHSGDIISKIPKGLSLSLIVMTVSVLVKLVKN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g7303.t31 | Gene3D | G3DSA:3.40.50.300 | - | 1 | 95 | 5.3E-19 |
| 2 | g7303.t31 | PANTHER | PTHR11711 | ADP RIBOSYLATION FACTOR-RELATED | 1 | 69 | 6.2E-38 |
| 3 | g7303.t31 | PANTHER | PTHR11711:SF357 | ADP-RIBOSYLATION FACTOR 1 | 1 | 69 | 6.2E-38 |
| 1 | g7303.t31 | Pfam | PF00025 | ADP-ribosylation factor family | 6 | 66 | 3.3E-23 |
| 7 | g7303.t31 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 84 | - |
| 9 | g7303.t31 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 85 | 102 | - |
| 8 | g7303.t31 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 103 | 104 | - |
| 5 | g7303.t31 | SMART | SM00177 | arf_sub_2 | 1 | 101 | 5.6E-6 |
| 4 | g7303.t31 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 13 | 65 | 4.76E-16 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005525 | GTP binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed