| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7303 | g7303.t32 | TTS | g7303.t32 | 22847929 | 22847929 |
| chr_2 | g7303 | g7303.t32 | isoform | g7303.t32 | 22848080 | 22849147 |
| chr_2 | g7303 | g7303.t32 | exon | g7303.t32.exon1 | 22848080 | 22848182 |
| chr_2 | g7303 | g7303.t32 | exon | g7303.t32.exon2 | 22848249 | 22848310 |
| chr_2 | g7303 | g7303.t32 | exon | g7303.t32.exon3 | 22848511 | 22848675 |
| chr_2 | g7303 | g7303.t32 | cds | g7303.t32.CDS1 | 22848569 | 22848675 |
| chr_2 | g7303 | g7303.t32 | exon | g7303.t32.exon4 | 22848744 | 22848824 |
| chr_2 | g7303 | g7303.t32 | cds | g7303.t32.CDS2 | 22848744 | 22848824 |
| chr_2 | g7303 | g7303.t32 | exon | g7303.t32.exon5 | 22848955 | 22849009 |
| chr_2 | g7303 | g7303.t32 | cds | g7303.t32.CDS3 | 22848955 | 22849009 |
| chr_2 | g7303 | g7303.t32 | exon | g7303.t32.exon6 | 22849085 | 22849147 |
| chr_2 | g7303 | g7303.t32 | cds | g7303.t32.CDS4 | 22849085 | 22849147 |
| chr_2 | g7303 | g7303.t32 | TSS | g7303.t32 | 22849846 | 22849846 |
>g7303.t32 Gene=g7303 Length=529
ATGGGAAACGTATTTGCTAATCTGTTCAAAGGTTTATTTGGTAAAAAGGAGATGAGAATA
TTGATGGTTGGTCTCGATGCTGCTGGTAAAACGACAATTTTATACAAGCTTAAATTAGGT
GAAATTGTAACTACAATCCCAACCATTGGCTTCAACGTTGAAACTGTAGAATACAAAAAT
ATTTCATTTACTGTTTGGGATGTTGGTGGTCAAGACAAAATCCGCCCACTCTGGAGACAT
TATTTCCAAAATACCCAAGTAAGTAGCATTATCACTACATTCATACATTTAATTTCATAT
TTATAAAATTGACATGAACCTTATAATTAATTGATTTTCATTTTTTTTTTTCTAAAAAAC
TAGGGATTTGCCCAATGCTATGAATGCAGCCGAAATCACAGATAAATTAGGTCTTCACTC
ATTACGAAACCGAAGCTGGTATATTCAAGCAACGTGTGCAACCAGTGGAGATGGCCTCTA
TGAAGGTTTGGATTGGCTTTCGAATCAACTGAAGAACGCTAACCGCTAA
>g7303.t32 Gene=g7303 Length=101
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQVSSIITTFIHLISYL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g7303.t32 | Gene3D | G3DSA:3.40.50.300 | - | 18 | 92 | 0.0000000 |
| 2 | g7303.t32 | PANTHER | PTHR11711 | ADP RIBOSYLATION FACTOR-RELATED | 1 | 88 | 0.0000000 |
| 3 | g7303.t32 | PANTHER | PTHR11711:SF357 | ADP-RIBOSYLATION FACTOR 1 | 1 | 88 | 0.0000000 |
| 4 | g7303.t32 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 19 | 42 | 0.0000001 |
| 5 | g7303.t32 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 47 | 71 | 0.0000001 |
| 1 | g7303.t32 | Pfam | PF00025 | ADP-ribosylation factor family | 6 | 87 | 0.0000000 |
| 9 | g7303.t32 | ProSiteProfiles | PS51417 | small GTPase Arf family profile. | 11 | 101 | 10.3220000 |
| 8 | g7303.t32 | SMART | SM00177 | arf_sub_2 | 1 | 101 | 0.0000000 |
| 6 | g7303.t32 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 13 | 87 | 0.0000000 |
| 10 | g7303.t32 | TIGRFAM | TIGR00231 | small_GTP: small GTP-binding protein domain | 16 | 88 | 0.0000000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005525 | GTP binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed