General information for g7303.t35
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as ADP-ribosylation factor 1.
Parent gene
- The parent gene g7303 is located on chr_2: 22848898..22849864 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7303 | g7303.t35 | TTS | g7303.t35 | 22847929 | 22847929 |
| chr_2 | g7303 | g7303.t35 | isoform | g7303.t35 | 22848080 | 22849267 |
| chr_2 | g7303 | g7303.t35 | exon | g7303.t35.exon1 | 22848080 | 22848182 |
| chr_2 | g7303 | g7303.t35 | cds | g7303.t35.CDS1 | 22848080 | 22848182 |
| chr_2 | g7303 | g7303.t35 | exon | g7303.t35.exon2 | 22848249 | 22848310 |
| chr_2 | g7303 | g7303.t35 | cds | g7303.t35.CDS2 | 22848249 | 22848310 |
| chr_2 | g7303 | g7303.t35 | exon | g7303.t35.exon3 | 22848386 | 22848511 |
| chr_2 | g7303 | g7303.t35 | cds | g7303.t35.CDS3 | 22848386 | 22848511 |
| chr_2 | g7303 | g7303.t35 | exon | g7303.t35.exon4 | 22848626 | 22848675 |
| chr_2 | g7303 | g7303.t35 | cds | g7303.t35.CDS4 | 22848626 | 22848675 |
| chr_2 | g7303 | g7303.t35 | exon | g7303.t35.exon5 | 22848744 | 22848824 |
| chr_2 | g7303 | g7303.t35 | cds | g7303.t35.CDS5 | 22848744 | 22848824 |
| chr_2 | g7303 | g7303.t35 | exon | g7303.t35.exon6 | 22848955 | 22849009 |
| chr_2 | g7303 | g7303.t35 | cds | g7303.t35.CDS6 | 22848955 | 22849009 |
| chr_2 | g7303 | g7303.t35 | exon | g7303.t35.exon7 | 22849085 | 22849267 |
| chr_2 | g7303 | g7303.t35 | cds | g7303.t35.CDS7 | 22849085 | 22849147 |
| chr_2 | g7303 | g7303.t35 | TSS | g7303.t35 | 22849846 | 22849846 |
Sequences
>g7303.t35 Gene=g7303 Length=660
CTAAACACAAGAAAAACTATAATTTAGAAAGGAAACTGCGAGTGCAAGAGGAGAAAAAAA
GAAGATTGTGTGTGACCTGTGAAATTATATACATTCGAAAAGAAGACTTAATAAATAAAG
ATGGGAAACGTATTTGCTAATCTGTTCAAAGGTTTATTTGGTAAAAAGGAGATGAGAATA
TTGATGGTTGGTCTCGATGCTGCTGGTAAAACGACAATTTTATACAAGCTTAAATTAGGT
GAAATTGTAACTACAATCCCAACCATTGGCTTCAACGTTGAAACTGTAGAATACAAAAAT
ATTTCATTTACTGTTTGGGATGTTGGTGGTCAAGACAAAATCCGCCCACTCTGGAGACAT
TATTTCCAAGGGCTTATCTTTGTCGTTGATAGTAATGACCGTGAGCGTGTTGGTGAAGCT
CGTGAAGAATTAATGAGAATGTTGGCTGAAGATGAATTGAGGGATGCTGTGCTTTTAATT
TTTGCCAACAAGCAGGATTTGCCCAATGCTATGAATGCAGCCGAAATCACAGATAAATTA
GGTCTTCACTCATTACGAAACCGAAGCTGGTATATTCAAGCAACGTGTGCAACCAGTGGA
GATGGCCTCTATGAAGGTTTGGATTGGCTTTCGAATCAACTGAAGAACGCTAACCGCTAA
>g7303.t35 Gene=g7303 Length=179
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLI
FANKQDLPNAMNAAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNANR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g7303.t35 | CDD | cd04150 | Arf1_5_like | 18 | 173 | 0.000 |
| 8 | g7303.t35 | Gene3D | G3DSA:3.40.50.300 | - | 18 | 174 | 0.000 |
| 2 | g7303.t35 | PANTHER | PTHR11711 | ADP RIBOSYLATION FACTOR-RELATED | 1 | 177 | 0.000 |
| 3 | g7303.t35 | PANTHER | PTHR11711:SF357 | ADP-RIBOSYLATION FACTOR 1 | 1 | 177 | 0.000 |
| 4 | g7303.t35 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 19 | 42 | 0.000 |
| 6 | g7303.t35 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 47 | 71 | 0.000 |
| 5 | g7303.t35 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 116 | 137 | 0.000 |
| 1 | g7303.t35 | Pfam | PF00025 | ADP-ribosylation factor family | 7 | 173 | 0.000 |
| 13 | g7303.t35 | ProSiteProfiles | PS51417 | small GTPase Arf family profile. | 11 | 174 | 23.569 |
| 10 | g7303.t35 | SMART | SM00177 | arf_sub_2 | 1 | 178 | 0.000 |
| 11 | g7303.t35 | SMART | SM00178 | sar_sub_1 | 1 | 174 | 0.000 |
| 7 | g7303.t35 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 14 | 177 | 0.000 |
| 12 | g7303.t35 | TIGRFAM | TIGR00231 | small_GTP: small GTP-binding protein domain | 16 | 155 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005525 | GTP binding | MF |
KEGG
Orthology
- This transcript has been annotated with K07937 (ADP-ribosylation factor 1/2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed