General information for g7304.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g7304 is located on chr_2: 22850187..22850693 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7304 | g7304.t1 | TTS | g7304.t1 | 22850045 | 22850045 |
| chr_2 | g7304 | g7304.t1 | isoform | g7304.t1 | 22850187 | 22850693 |
| chr_2 | g7304 | g7304.t1 | exon | g7304.t1.exon1 | 22850187 | 22850233 |
| chr_2 | g7304 | g7304.t1 | cds | g7304.t1.CDS1 | 22850187 | 22850233 |
| chr_2 | g7304 | g7304.t1 | exon | g7304.t1.exon2 | 22850301 | 22850457 |
| chr_2 | g7304 | g7304.t1 | cds | g7304.t1.CDS2 | 22850301 | 22850457 |
| chr_2 | g7304 | g7304.t1 | exon | g7304.t1.exon3 | 22850646 | 22850693 |
| chr_2 | g7304 | g7304.t1 | cds | g7304.t1.CDS3 | 22850646 | 22850693 |
| chr_2 | g7304 | g7304.t1 | TSS | g7304.t1 | 22850791 | 22850791 |
Sequences
>g7304.t1 Gene=g7304 Length=252
ATGGCCATTGAGTTGGGAGCACCTGTACGAGTATCGCCATTAATTAGATTCGGTCGATGG
TCATTCCTCGGACTCGGAGTTCTATATGGCGCTTACCATCAATCAAGATTGTCAAAGAGA
GAAGTTGGAATTCGAGCAATTGAAGCTGAAAAGAAGGCCATTCGTGATGCAAAGGCAGCA
GAAGAAAAGAAGAGAGCACTAGAAGAGGAAGCTAGAGCAATTGCTGATTTATCAAGTCCA
ACAAAGAAGTAA
>g7304.t1 Gene=g7304 Length=83
MAIELGAPVRVSPLIRFGRWSFLGLGVLYGAYHQSRLSKREVGIRAIEAEKKAIRDAKAA
EEKKRALEEEARAIADLSSPTKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g7304.t1 | Coils | Coil | Coil | 44 | 77 | - |
| 2 | g7304.t1 | PANTHER | PTHR12427 | ATP SYNTHASE E CHAIN, MITOCHONDRIAL | 7 | 80 | 9.7E-26 |
| 1 | g7304.t1 | Pfam | PF05680 | ATP synthase E chain | 7 | 79 | 1.6E-24 |
| 5 | g7304.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 13 | - |
| 6 | g7304.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 14 | 32 | - |
| 4 | g7304.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 33 | 83 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0015986 | ATP synthesis coupled proton transport | BP |
| GO:0000276 | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | CC |
| GO:0015078 | proton transmembrane transporter activity | MF |
KEGG
Orthology
- This transcript has been annotated with K02129 (F-type H+-transporting ATPase subunit e)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
