Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g7317 g7317.t6 isoform g7317.t6 22880399 22880816
chr_2 g7317 g7317.t6 exon g7317.t6.exon1 22880399 22880415
chr_2 g7317 g7317.t6 exon g7317.t6.exon2 22880484 22880816
chr_2 g7317 g7317.t6 cds g7317.t6.CDS1 22880509 22880814
chr_2 g7317 g7317.t6 TTS g7317.t6 22881352 22881352
chr_2 g7317 g7317.t6 TSS g7317.t6 NA NA

Sequences

>g7317.t6 Gene=g7317 Length=350
ACTGAAGCTCTTCGAAAGAAGGAGAAAGAATATGAGGAGACAATGGATCATTTGCAGAGT
GACATTGATTCTCTAGAAAATGAACGTGGTGTTTTAAGAGAAAAACTTAAAACATATAGC
AATAAGAAGGGAGATTTAAAGACAACCACAGCTCTTGATATAACAGCAAGTTCGCCTCAT
ATTGCACAAGAACTTACACTTTTACAAAAAGCACTAAAAGACGAACGCGAATCTAGAATG
AAATTGCAAGCTCAAGAATATGAAAAGATTCTAAAGAGTCTTGCACCAATTCATGTTCCT
AAACTTAGAGATCCAAAACTTGATGCACTTGATGAAGAACTGAGAAAAGT

>g7317.t6 Gene=g7317 Length=102
MDHLQSDIDSLENERGVLREKLKTYSNKKGDLKTTTALDITASSPHIAQELTLLQKALKD
ERESRMKLQAQEYEKILKSLAPIHVPKLRDPKLDALDEELRK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g7317.t6 Coils Coil Coil 1 28 -
1 g7317.t6 Coils Coil Coil 51 71 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values