| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7321 | g7321.t2 | TTS | g7321.t2 | 22940445 | 22940445 |
| chr_2 | g7321 | g7321.t2 | isoform | g7321.t2 | 22940724 | 22941257 |
| chr_2 | g7321 | g7321.t2 | exon | g7321.t2.exon1 | 22940724 | 22940909 |
| chr_2 | g7321 | g7321.t2 | cds | g7321.t2.CDS1 | 22940724 | 22940909 |
| chr_2 | g7321 | g7321.t2 | exon | g7321.t2.exon2 | 22940971 | 22941086 |
| chr_2 | g7321 | g7321.t2 | cds | g7321.t2.CDS2 | 22940971 | 22940976 |
| chr_2 | g7321 | g7321.t2 | exon | g7321.t2.exon3 | 22941156 | 22941257 |
| chr_2 | g7321 | g7321.t2 | TSS | g7321.t2 | NA | NA |
>g7321.t2 Gene=g7321 Length=404
ATGAGGGCATTGATGCTGTTAAACAAGCTTTGCGTGCTGGTCTTGAAACATCAACTGAAG
ATATTCCAATTAAAATCAATTTGATTGCGCCGCCCATTTATGTCATAACGACATCGACTC
CTGAAAAAAATGATGGTCTTAAGGCTCTTGAAAATGCCATAGATAAAATCAAGTCTACAA
TTGAGAAGCTTGACGGACATTTTGCTATTCAAATGGCGCCTAAAGTTGTTACTGCAATTG
ATGAAGCTGATTTAGCAAGACGAATGGAACGCGCTGAAATGGAAAATGCAGAAGTTTCAG
GAGATGAAGATGAAAGTGAAGAGGAAGAAGGTATGAAATTCGATGCTGATGAGAATGATA
CAGGTGACAAAAATTCAGACAAATCAGGTTCTGACGATGAATAA
>g7321.t2 Gene=g7321 Length=63
MAPKVVTAIDEADLARRMERAEMENAEVSGDEDESEEEEGMKFDADENDTGDKNSDKSGS
DDE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g7321.t2 | Coils | Coil | Coil | 18 | 38 | - |
| 2 | g7321.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 16 | 63 | - |
| 1 | g7321.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 26 | 45 | - |
| 3 | g7321.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 46 | 63 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.