General information for g7354.t11
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g7354 is located on chr_2: 23350197..23352881 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7354 | g7354.t11 | TTS | g7354.t11 | 23341880 | 23341880 |
| chr_2 | g7354 | g7354.t11 | isoform | g7354.t11 | 23342071 | 23342890 |
| chr_2 | g7354 | g7354.t11 | exon | g7354.t11.exon1 | 23342071 | 23342163 |
| chr_2 | g7354 | g7354.t11 | cds | g7354.t11.CDS1 | 23342071 | 23342163 |
| chr_2 | g7354 | g7354.t11 | exon | g7354.t11.exon2 | 23342261 | 23342409 |
| chr_2 | g7354 | g7354.t11 | cds | g7354.t11.CDS2 | 23342261 | 23342359 |
| chr_2 | g7354 | g7354.t11 | exon | g7354.t11.exon3 | 23342504 | 23342585 |
| chr_2 | g7354 | g7354.t11 | exon | g7354.t11.exon4 | 23342877 | 23342890 |
| chr_2 | g7354 | g7354.t11 | TSS | g7354.t11 | NA | NA |
Sequences
>g7354.t11 Gene=g7354 Length=338
CAGCCATTCTTGATAAATGCGTTACAGCCCTCGATAAGACTTGGCACACTGAACATTTCT
TCTGTGCACAGTGTGGGCAACAATTTGGAGATGAAGGTTTTCATGAACGCGATGGCAAAC
CATATTGTCGTAAGGATTATTTTGATATGTTTGCACCACGCTGTGCCGGATGCAATCAAG
CGATCATGGAAAATTACATATCTGCATTGAACAGTCAATTTCATCCTGATTGCTTCGTTT
GTAGAGATTGTAAGCAGGCAGTAACTGGAAAATCATTTTATGCTATGGAAGGCAAACCCG
TCTGTCCAAAATGTGTCGGTGTCGATGAAGAAGATTGA
>g7354.t11 Gene=g7354 Length=63
MFAPRCAGCNQAIMENYISALNSQFHPDCFVCRDCKQAVTGKSFYAMEGKPVCPKCVGVD
EED
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g7354.t11 | Gene3D | G3DSA:2.10.110.10 | Cysteine Rich Protein | 1 | 62 | 4.5E-22 |
| 2 | g7354.t11 | PANTHER | PTHR24216:SF11 | PAXILLIN | 1 | 48 | 6.5E-15 |
| 3 | g7354.t11 | PANTHER | PTHR24216 | PAXILLIN-RELATED | 1 | 48 | 6.5E-15 |
| 1 | g7354.t11 | Pfam | PF00412 | LIM domain | 6 | 56 | 2.8E-15 |
| 7 | g7354.t11 | ProSitePatterns | PS00478 | LIM zinc-binding domain signature. | 6 | 39 | - |
| 9 | g7354.t11 | ProSiteProfiles | PS50023 | LIM domain profile. | 4 | 63 | 12.543 |
| 6 | g7354.t11 | SMART | SM00132 | lim_4 | 5 | 56 | 1.3E-15 |
| 5 | g7354.t11 | SUPERFAMILY | SSF57716 | Glucocorticoid receptor-like (DNA-binding domain) | 1 | 36 | 1.35E-9 |
| 4 | g7354.t11 | SUPERFAMILY | SSF57716 | Glucocorticoid receptor-like (DNA-binding domain) | 31 | 57 | 1.08E-5 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007160 | cell-matrix adhesion | BP |
| GO:0005856 | cytoskeleton | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed