General information for g7364.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Peroxisomal membrane protein 2.
Parent gene
- The parent gene g7364 is located on chr_2: 23399701..23407796 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7364 | g7364.t1 | TSS | g7364.t1 | 23399094 | 23399094 |
| chr_2 | g7364 | g7364.t1 | isoform | g7364.t1 | 23399150 | 23399775 |
| chr_2 | g7364 | g7364.t1 | exon | g7364.t1.exon1 | 23399150 | 23399238 |
| chr_2 | g7364 | g7364.t1 | cds | g7364.t1.CDS1 | 23399150 | 23399238 |
| chr_2 | g7364 | g7364.t1 | exon | g7364.t1.exon2 | 23399307 | 23399775 |
| chr_2 | g7364 | g7364.t1 | cds | g7364.t1.CDS2 | 23399307 | 23399775 |
| chr_2 | g7364 | g7364.t1 | TTS | g7364.t1 | 23400127 | 23400127 |
Sequences
>g7364.t1 Gene=g7364 Length=558
ATGGCTTTATCAAGACCAATTTATAACTTTCTTGGCTTTTATTTTGAACAACTTTTCAAT
CATCCCGTTAGAACAAAATCAATAACAAGCTGCACAGTTGCAACGGCCGGTGCCTTAGCT
TCACAATCACTCTCAGGACAAAAAATCAACCCACGAGCAGTTTTTGCATATTCAATTTTT
GGACTTTTATTTGGCGGTTCTGTGCCACATTATTTCTTTAACTTTTTTGAGTCTGTTGTT
CCTGATGTCCCTTATAAAAAGCTCATTGAGTTTTTACTTGAACGTTCAGTGTTTGCACCT
GTTTTTACTGCTATGAGTCTTTACTTCTTATCAATTTTCGAAGGAAAGAGTCCTGAACAA
GCACTCAAGACATTGCAACAATTATATTTAACGGTATTGACAACAAACTGGAGATACCTA
TCATTACCCGTCTTTATCAATTTCAATTTTGTTCCTCTGTTTCTTCGTGTTTTCGTCGCC
AATCTCATTGGCTTTTTCTGGATTATTTATTTAGCTGATAAGAGACGTAGAGCAGCAGCA
AAAAAAGAAAATAACTAA
>g7364.t1 Gene=g7364 Length=185
MALSRPIYNFLGFYFEQLFNHPVRTKSITSCTVATAGALASQSLSGQKINPRAVFAYSIF
GLLFGGSVPHYFFNFFESVVPDVPYKKLIEFLLERSVFAPVFTAMSLYFLSIFEGKSPEQ
ALKTLQQLYLTVLTTNWRYLSLPVFINFNFVPLFLRVFVANLIGFFWIIYLADKRRRAAA
KKENN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g7364.t1 | PANTHER | PTHR11266:SF80 | PEROXISOMAL MEMBRANE PROTEIN 2 | 11 | 172 | 2.4E-30 |
| 3 | g7364.t1 | PANTHER | PTHR11266 | PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 MPV17 | 11 | 172 | 2.4E-30 |
| 1 | g7364.t1 | Pfam | PF04117 | Mpv17 / PMP22 family | 112 | 171 | 1.5E-15 |
| 7 | g7364.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 53 | - |
| 13 | g7364.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 76 | - |
| 10 | g7364.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 77 | 95 | - |
| 12 | g7364.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 96 | 115 | - |
| 6 | g7364.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 116 | 126 | - |
| 14 | g7364.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 127 | 147 | - |
| 9 | g7364.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 148 | 152 | - |
| 11 | g7364.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 153 | 172 | - |
| 8 | g7364.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 173 | 185 | - |
| 5 | g7364.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 76 | - |
| 4 | g7364.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 150 | 172 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K13347 (peroxisomal membrane protein 2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
