Gene loci information

Transcript annotation

  • This transcript has been annotated as Diuretic hormone receptor.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g7384 g7384.t2 isoform g7384.t2 23497675 23513336
chr_2 g7384 g7384.t2 exon g7384.t2.exon1 23497675 23497720
chr_2 g7384 g7384.t2 cds g7384.t2.CDS1 23497675 23497720
chr_2 g7384 g7384.t2 exon g7384.t2.exon2 23502054 23502172
chr_2 g7384 g7384.t2 cds g7384.t2.CDS2 23502054 23502172
chr_2 g7384 g7384.t2 exon g7384.t2.exon3 23502294 23502417
chr_2 g7384 g7384.t2 cds g7384.t2.CDS3 23502294 23502417
chr_2 g7384 g7384.t2 exon g7384.t2.exon4 23507065 23507281
chr_2 g7384 g7384.t2 cds g7384.t2.CDS4 23507065 23507281
chr_2 g7384 g7384.t2 exon g7384.t2.exon5 23508998 23509091
chr_2 g7384 g7384.t2 cds g7384.t2.CDS5 23508998 23509091
chr_2 g7384 g7384.t2 exon g7384.t2.exon6 23509946 23510042
chr_2 g7384 g7384.t2 cds g7384.t2.CDS6 23509946 23510042
chr_2 g7384 g7384.t2 exon g7384.t2.exon7 23510928 23511008
chr_2 g7384 g7384.t2 cds g7384.t2.CDS7 23510928 23511008
chr_2 g7384 g7384.t2 exon g7384.t2.exon8 23512215 23512423
chr_2 g7384 g7384.t2 cds g7384.t2.CDS8 23512215 23512423
chr_2 g7384 g7384.t2 exon g7384.t2.exon9 23512819 23513180
chr_2 g7384 g7384.t2 cds g7384.t2.CDS9 23512819 23513180
chr_2 g7384 g7384.t2 exon g7384.t2.exon10 23513306 23513336
chr_2 g7384 g7384.t2 cds g7384.t2.CDS10 23513306 23513336
chr_2 g7384 g7384.t2 TSS g7384.t2 NA NA
chr_2 g7384 g7384.t2 TTS g7384.t2 NA NA

Sequences

>g7384.t2 Gene=g7384 Length=1380
ATGTTTCAAACAAATTTGAAAAAAAATCCCGAACGGCTTTTCCTAGTGGCGTTTACAAAT
CTTACATTAATTGGTGCCGATGAGCATCTACTGCTAAGAACTAATAGCAGTATTGAATTA
AGTTGTTTAGCAGAAATTGAAGCTGATAAAATTCTTCATCCTAAGAATGACAGCGAATAT
TGCCGACCAAATTTTGATGAAGTACTGTGCTGGCCAAGAACGAAATTCGATACGACTGTC
GTACAGCCGTGTTTTTCGGAATTTCACAATGTCAAATATGACGTTACAAATAATGCAACG
AGATATTGCAGTGTAACAGGTCAATGGGATCTCTCAAATTATCTTAATTGCCACCCAATA
AGTCCAATGAATCGAAGTTGCAGTGAATGGGACTTTTCATGGGATATTAGATGTTCAGCT
TATGCCACCAGCATTATTTATTACATTGGATACACAATAAGCCTCATCGCACTCATATTG
GCTGTAATTGTTTTCATGAATTTCAAAGAACTTCGATGTTTGAGAAATACCATTCACATA
AATTTATTTTTAACTTACATTTTATCGATATTTTTATGGATTTTAACACTAACATTGCAG
ATGTTTTTGGGCAATGGCAGCACAGTTGGTTGTATATTTTCAGCAATATTTCTTCATTAT
TTTATGCTCACAAACTTTTTTTGGATGCTTGTGGAAGGTCTCTATCTCTATATGCTGGTT
GTACAAACATTTTCCGGCGATAACATCCGATTTAATCTATATTTTATCATTGGATACGGC
TTTCCAAGTATATTCGTGGGTTTTTGGACGATATTTAAAGCGCTTCAAACTGAATCAGAC
AATGAAATTGCTGCAAGCACACCATCCGAGACTGAATCTCGTCTTGTTTGTTCATGGATG
CGAGAATCGAATATCGATTGGATCATTCAAGGCCCAGCATGCGGTGTTCTTATTATAAAT
CTTATTTTTTTGATTCGAATTATGTGGGTACTTATAACAAAATTGCGTTCAGCAAATACC
GTAGAAACGAGGCAATATCGAAAAGCATCAAAAGCTCTTCTCGTGCTAATTCCATTGCTA
GGTATAACATATTTAGTAGTCATTGCGGGTCCGAGTACTGGCGTTGAAAGTCACATTTTT
GCGATACTTCGTGCAGTTTTATTAAGTATTCAAGGTTTCTGCGTGGCACTTTTTTATTGC
TTTTTCAATTCAGAAGTGCGACAAGCATTAAAGCATCGTTTCCATCGATTAAGAGATTCA
CGCACACTTAGCGCATCAAATTCAATAAGAAGTCGACGTTATACAATGTCTAAAGACTAC
TCACCTCGATCTAGAACTGAAAGCATACGCTTAACTACAACTCTTCCTTTAACATCGTAA

>g7384.t2 Gene=g7384 Length=459
MFQTNLKKNPERLFLVAFTNLTLIGADEHLLLRTNSSIELSCLAEIEADKILHPKNDSEY
CRPNFDEVLCWPRTKFDTTVVQPCFSEFHNVKYDVTNNATRYCSVTGQWDLSNYLNCHPI
SPMNRSCSEWDFSWDIRCSAYATSIIYYIGYTISLIALILAVIVFMNFKELRCLRNTIHI
NLFLTYILSIFLWILTLTLQMFLGNGSTVGCIFSAIFLHYFMLTNFFWMLVEGLYLYMLV
VQTFSGDNIRFNLYFIIGYGFPSIFVGFWTIFKALQTESDNEIAASTPSETESRLVCSWM
RESNIDWIIQGPACGVLIINLIFLIRIMWVLITKLRSANTVETRQYRKASKALLVLIPLL
GITYLVVIAGPSTGVESHIFAILRAVLLSIQGFCVALFYCFFNSEVRQALKHRFHRLRDS
RTLSASNSIRSRRYTMSKDYSPRSRTESIRLTTTLPLTS

Protein features from InterProScan

Transcript Database ID Name Start End E.value
20 g7384.t2 Gene3D G3DSA:4.10.1240.10 Hormone receptor superfamily 30 130 4.3E-20
19 g7384.t2 Gene3D G3DSA:1.20.1070.10 - 135 438 2.0E-82
3 g7384.t2 PANTHER PTHR45620 PDF RECEPTOR-LIKE PROTEIN-RELATED 37 447 2.9E-137
4 g7384.t2 PANTHER PTHR45620:SF15 DIURETIC HORMONE 44 RECEPTOR 1-RELATED 37 447 2.9E-137
15 g7384.t2 PRINTS PR01127 Diuretic hormone receptor signature 84 103 1.1E-25
7 g7384.t2 PRINTS PR00249 Secretin-like GPCR superfamily signature 145 169 2.0E-55
11 g7384.t2 PRINTS PR00249 Secretin-like GPCR superfamily signature 177 201 2.0E-55
6 g7384.t2 PRINTS PR00249 Secretin-like GPCR superfamily signature 213 236 2.0E-55
14 g7384.t2 PRINTS PR01127 Diuretic hormone receptor signature 239 254 1.1E-25
8 g7384.t2 PRINTS PR00249 Secretin-like GPCR superfamily signature 251 276 2.0E-55
16 g7384.t2 PRINTS PR01127 Diuretic hormone receptor signature 295 310 1.1E-25
9 g7384.t2 PRINTS PR00249 Secretin-like GPCR superfamily signature 307 332 2.0E-55
10 g7384.t2 PRINTS PR00249 Secretin-like GPCR superfamily signature 349 369 2.0E-55
13 g7384.t2 PRINTS PR01127 Diuretic hormone receptor signature 361 374 1.1E-25
5 g7384.t2 PRINTS PR00249 Secretin-like GPCR superfamily signature 381 402 2.0E-55
12 g7384.t2 PRINTS PR01127 Diuretic hormone receptor signature 437 450 1.1E-25
1 g7384.t2 Pfam PF02793 Hormone receptor domain 59 118 2.6E-14
2 g7384.t2 Pfam PF00002 7 transmembrane receptor (Secretin family) 142 395 8.1E-63
29 g7384.t2 Phobius SIGNAL_PEPTIDE Signal peptide region 1 26 -
30 g7384.t2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 12 -
31 g7384.t2 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 13 21 -
39 g7384.t2 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 22 26 -
27 g7384.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 27 144 -
34 g7384.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 145 168 -
24 g7384.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 169 179 -
33 g7384.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 180 203 -
26 g7384.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 204 214 -
37 g7384.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 215 239 -
21 g7384.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 240 250 -
36 g7384.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 251 272 -
25 g7384.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 273 306 -
35 g7384.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 307 332 -
23 g7384.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 333 352 -
32 g7384.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 353 373 -
28 g7384.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 374 378 -
38 g7384.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 379 402 -
22 g7384.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 403 459 -
47 g7384.t2 ProSitePatterns PS00649 G-protein coupled receptors family 2 signature 1. 61 85 -
50 g7384.t2 ProSiteProfiles PS50227 G-protein coupled receptors family 2 profile 1. 41 121 16.309
49 g7384.t2 ProSiteProfiles PS50261 G-protein coupled receptors family 2 profile 2. 143 403 40.835
48 g7384.t2 SMART SM00008 HormR_1 57 126 6.2E-14
18 g7384.t2 SUPERFAMILY SSF111418 Hormone receptor domain 38 121 1.57E-20
17 g7384.t2 SUPERFAMILY SSF81321 Family A G protein-coupled receptor-like 132 432 1.19E-12
46 g7384.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 146 168 -
44 g7384.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 180 202 -
43 g7384.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 217 239 -
42 g7384.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 251 272 -
41 g7384.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 308 330 -
45 g7384.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 353 375 -
40 g7384.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 380 402 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0016020 membrane CC
GO:0007186 G protein-coupled receptor signaling pathway BP
GO:0008036 diuretic hormone receptor activity MF
GO:0016021 integral component of membrane CC
GO:0004888 transmembrane signaling receptor activity MF
GO:0007166 cell surface receptor signaling pathway BP
GO:0004930 G protein-coupled receptor activity MF

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed