General information for g7404.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Histone H2A.
Parent gene
- The parent gene g7404 is located on chr_2: 23587773..23588331 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7404 | g7404.t1 | isoform | g7404.t1 | 23587773 | 23588084 |
| chr_2 | g7404 | g7404.t1 | exon | g7404.t1.exon1 | 23587773 | 23588084 |
| chr_2 | g7404 | g7404.t1 | cds | g7404.t1.CDS1 | 23587773 | 23588084 |
| chr_2 | g7404 | g7404.t1 | TTS | g7404.t1 | 23588331 | 23588331 |
| chr_2 | g7404 | g7404.t1 | TSS | g7404.t1 | NA | NA |
Sequences
>g7404.t1 Gene=g7404 Length=312
ATGGTGAACGTGTTGGTGCTGGTGCTCCAGTATATTGTGGCTGCTGTCATGGAATATTTG
GCTGCTGAAGTTCTCGAGTTGGCTGGTAATGCTGCTCGTGATAACAAAAAGACAAGAATT
ATTCCACGTCACTTGCAATTGGCCATCCGTAATGACGAAGAATTAAATAAACTTCTCTCA
GGCGTCACAATCGCTCAAGGTGGTGTTTTACCAAATATTCAAGCTGTCTTATTGCCAAAG
AAGACCGAAACAAAGAAAAACTGCTTAAATCAGTCATCAAAGAACATCTCAAAACAAAAC
CGTCCTTTTTAG
>g7404.t1 Gene=g7404 Length=103
MVNVLVLVLQYIVAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLS
GVTIAQGGVLPNIQAVLLPKKTETKKNCLNQSSKNISKQNRPF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g7404.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 9 | 89 | 3.0E-40 |
| 3 | g7404.t1 | PANTHER | PTHR23430:SF222 | HISTONE H2A | 13 | 87 | 1.2E-42 |
| 4 | g7404.t1 | PANTHER | PTHR23430 | HISTONE H2A | 13 | 87 | 1.2E-42 |
| 5 | g7404.t1 | PRINTS | PR00620 | Histone H2A signature | 4 | 19 | 2.3E-29 |
| 8 | g7404.t1 | PRINTS | PR00620 | Histone H2A signature | 19 | 32 | 2.3E-29 |
| 7 | g7404.t1 | PRINTS | PR00620 | Histone H2A signature | 33 | 47 | 2.3E-29 |
| 6 | g7404.t1 | PRINTS | PR00620 | Histone H2A signature | 61 | 79 | 2.3E-29 |
| 2 | g7404.t1 | Pfam | PF00125 | Core histone H2A/H2B/H3/H4 | 12 | 50 | 5.3E-7 |
| 1 | g7404.t1 | Pfam | PF16211 | C-terminus of histone H2A | 53 | 86 | 5.9E-21 |
| 13 | g7404.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 22 | - |
| 14 | g7404.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 15 | g7404.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 15 | - |
| 16 | g7404.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 16 | 22 | - |
| 12 | g7404.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 23 | 103 | - |
| 17 | g7404.t1 | SMART | SM00414 | h2a4 | 9 | 84 | 6.5E-29 |
| 9 | g7404.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 11 | 81 | 1.06E-26 |
| 10 | g7404.t1 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 21 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0000786 | nucleosome | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
