General information for g7410.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Histone H3.
Parent gene
- The parent gene g7410 is located on chr_2: 23606821..23607168 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7410 | g7410.t1 | isoform | g7410.t1 | 23606821 | 23607168 |
| chr_2 | g7410 | g7410.t1 | exon | g7410.t1.exon1 | 23606821 | 23607168 |
| chr_2 | g7410 | g7410.t1 | cds | g7410.t1.CDS1 | 23606821 | 23607168 |
| chr_2 | g7410 | g7410.t1 | TSS | g7410.t1 | NA | NA |
| chr_2 | g7410 | g7410.t1 | TTS | g7410.t1 | NA | NA |
Sequences
>g7410.t1 Gene=g7410 Length=348
ATGGCTCGTACAAAGCAAACCGCTCGTAAATCGACTGGAGGCAAAGCACCACGTAAGCAG
TTGGCCACAAAAGCTGCTCGCAAATCAGCACCAGCAACAGGAGGTGTAAAGAAACCACAT
CGTTATCGTCCAGGAACTGTCGCTCTTCGTGAAATTCGTCGCTATCAAAAATCGACAGAA
TTGTTGATCCGCAAACTGCCATTCCAACGCTTAGTTCGTGAAATTGCTCAAGATTTCAAG
ACTGATTTGCGTTTCCAATCATCAGCAGTTATGGCATTGCAAGAAGCATCAGAAGCTTAC
TTGGTCGGACTCTTCGAAGAACACAAACTTGTGCGCTATTCACGCTAA
>g7410.t1 Gene=g7410 Length=115
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEEHKLVRYSR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g7410.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 2 | 114 | 4.5E-59 |
| 15 | g7410.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 43 | - |
| 2 | g7410.t1 | PANTHER | PTHR11426 | HISTONE H3 | 1 | 110 | 7.7E-73 |
| 3 | g7410.t1 | PANTHER | PTHR11426:SF198 | - | 1 | 110 | 7.7E-73 |
| 5 | g7410.t1 | PRINTS | PR00622 | Histone H3 signature | 3 | 17 | 1.9E-63 |
| 7 | g7410.t1 | PRINTS | PR00622 | Histone H3 signature | 17 | 31 | 1.9E-63 |
| 9 | g7410.t1 | PRINTS | PR00622 | Histone H3 signature | 34 | 55 | 1.9E-63 |
| 4 | g7410.t1 | PRINTS | PR00622 | Histone H3 signature | 58 | 75 | 1.9E-63 |
| 6 | g7410.t1 | PRINTS | PR00622 | Histone H3 signature | 80 | 98 | 1.9E-63 |
| 8 | g7410.t1 | PRINTS | PR00622 | Histone H3 signature | 98 | 114 | 1.9E-63 |
| 1 | g7410.t1 | Pfam | PF00125 | Core histone H2A/H2B/H3/H4 | 1 | 107 | 1.6E-36 |
| 13 | g7410.t1 | ProSitePatterns | PS00322 | Histone H3 signature 1. | 15 | 21 | - |
| 12 | g7410.t1 | ProSitePatterns | PS00959 | Histone H3 signature 2. | 67 | 75 | - |
| 14 | g7410.t1 | SMART | SM00428 | h35 | 34 | 113 | 1.2E-37 |
| 10 | g7410.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 2 | 107 | 1.01E-40 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0000786 | nucleosome | CC |
KEGG
Orthology
- This transcript has been annotated with K11253 (histone H3)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed