Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g7412 g7412.t1 isoform g7412.t1 23609553 23609931
chr_2 g7412 g7412.t1 exon g7412.t1.exon1 23609553 23609707
chr_2 g7412 g7412.t1 cds g7412.t1.CDS1 23609553 23609707
chr_2 g7412 g7412.t1 exon g7412.t1.exon2 23609790 23609931
chr_2 g7412 g7412.t1 cds g7412.t1.CDS2 23609790 23609931
chr_2 g7412 g7412.t1 TSS g7412.t1 NA NA
chr_2 g7412 g7412.t1 TTS g7412.t1 NA NA

Sequences

>g7412.t1 Gene=g7412 Length=297
ATGGCACCACCAAAAACAAGCGGTAAAGCAGCAAAGAAAGCCGGAAAGGCTCAGAAGAAT
ATCTCAAAGGATGACAAGAAGAAGAAGCGTCATCGTCGTAAGGAATCATATGCAATTTAC
ATCTTCAAAGTCTTGAAAACAACTGAAGCATCACGCTTGGCTCATTACAACAAGCGCTCA
ACAATCACATCACGAGAAATCCAAACAGCCGTCCGTCTTCTCTTGCCTGGTGAATTGGCT
AAGCACGCTGTCTCAGAAGGCACAAAAGCTGTCACCAAATACACATCATCAAAGTAA

>g7412.t1 Gene=g7412 Length=98
MAPPKTSGKAAKKAGKAQKNISKDDKKKKRHRRKESYAIYIFKVLKTTEASRLAHYNKRS
TITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
12 g7412.t1 Gene3D G3DSA:1.10.20.10 Histone 1 47 2.1E-7
13 g7412.t1 Gene3D G3DSA:1.10.20.10 Histone 48 98 1.6E-27
11 g7412.t1 MobiDBLite mobidb-lite consensus disorder prediction 1 33 -
1 g7412.t1 PANTHER PTHR23428:SF125 HISTONE H2B 3-RELATED 1 47 9.4E-35
3 g7412.t1 PANTHER PTHR23428 HISTONE H2B 1 47 9.4E-35
2 g7412.t1 PANTHER PTHR23428:SF125 HISTONE H2B 3-RELATED 48 98 9.4E-35
4 g7412.t1 PANTHER PTHR23428 HISTONE H2B 48 98 9.4E-35
6 g7412.t1 PRINTS PR00621 Histone H2B signature 51 68 6.6E-26
5 g7412.t1 PRINTS PR00621 Histone H2B signature 68 81 6.6E-26
7 g7412.t1 PRINTS PR00621 Histone H2B signature 81 94 6.6E-26
10 g7412.t1 ProSitePatterns PS00357 Histone H2B signature. 65 87 -
9 g7412.t1 SMART SM00427 h2b3 27 96 6.5E-32
8 g7412.t1 SUPERFAMILY SSF47113 Histone-fold 9 98 2.18E-34

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0003677 DNA binding MF
GO:0046982 protein heterodimerization activity MF
GO:0000786 nucleosome CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values