General information for g7413.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g7413 is located on chr_2: 23610157..23610537 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7413 | g7413.t1 | isoform | g7413.t1 | 23610157 | 23610537 |
| chr_2 | g7413 | g7413.t1 | exon | g7413.t1.exon1 | 23610157 | 23610292 |
| chr_2 | g7413 | g7413.t1 | cds | g7413.t1.CDS1 | 23610157 | 23610292 |
| chr_2 | g7413 | g7413.t1 | exon | g7413.t1.exon2 | 23610452 | 23610537 |
| chr_2 | g7413 | g7413.t1 | cds | g7413.t1.CDS2 | 23610452 | 23610537 |
| chr_2 | g7413 | g7413.t1 | TTS | g7413.t1 | 23610587 | 23610587 |
| chr_2 | g7413 | g7413.t1 | TSS | g7413.t1 | NA | NA |
Sequences
>g7413.t1 Gene=g7413 Length=222
ATGTCAGGAAGAGGCAAAGGAGGCAAAGTTAAGGCAAAGGCAAAGTCACGATCAAGCCGT
GCTGGACTTCAATTCCAAGTCGGTCGTATTCATCGTCTTCTCCGCAAGGGAAACTATGGT
GAACGTGTTGGTGCTGGCGTCACAATCGCTCAAGGTGGTGTTTTACCAAATATTCAAGCT
GTCTTATTGCCAAAGAAGACCGAAACAAAGAAAACTGCTTAA
>g7413.t1 Gene=g7413 Length=73
MSGRGKGGKVKAKAKSRSSRAGLQFQVGRIHRLLRKGNYGERVGAGVTIAQGGVLPNIQA
VLLPKKTETKKTA
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g7413.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 2 | 46 | 2.5E-16 |
| 11 | g7413.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 47 | 73 | 4.4E-7 |
| 10 | g7413.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 22 | - |
| 3 | g7413.t1 | PANTHER | PTHR23430 | HISTONE H2A | 2 | 47 | 4.3E-27 |
| 5 | g7413.t1 | PANTHER | PTHR23430:SF225 | HISTONE H2A | 2 | 47 | 4.3E-27 |
| 2 | g7413.t1 | PANTHER | PTHR23430 | HISTONE H2A | 47 | 71 | 4.3E-27 |
| 4 | g7413.t1 | PANTHER | PTHR23430:SF225 | HISTONE H2A | 47 | 71 | 4.3E-27 |
| 6 | g7413.t1 | PRINTS | PR00620 | Histone H2A signature | 13 | 35 | 4.4E-13 |
| 7 | g7413.t1 | PRINTS | PR00620 | Histone H2A signature | 42 | 57 | 4.4E-13 |
| 1 | g7413.t1 | Pfam | PF16211 | C-terminus of histone H2A | 46 | 71 | 1.1E-14 |
| 9 | g7413.t1 | SMART | SM00414 | h2a4 | 3 | 69 | 2.8E-7 |
| 8 | g7413.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 3 | 55 | 3.02E-13 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0000786 | nucleosome | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed