| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7416 | g7416.t1 | isoform | g7416.t1 | 23614317 | 23614965 |
| chr_2 | g7416 | g7416.t1 | exon | g7416.t1.exon1 | 23614317 | 23614322 |
| chr_2 | g7416 | g7416.t1 | cds | g7416.t1.CDS1 | 23614317 | 23614322 |
| chr_2 | g7416 | g7416.t1 | exon | g7416.t1.exon2 | 23614569 | 23614767 |
| chr_2 | g7416 | g7416.t1 | cds | g7416.t1.CDS2 | 23614569 | 23614767 |
| chr_2 | g7416 | g7416.t1 | exon | g7416.t1.exon3 | 23614820 | 23614965 |
| chr_2 | g7416 | g7416.t1 | cds | g7416.t1.CDS3 | 23614820 | 23614965 |
| chr_2 | g7416 | g7416.t1 | TSS | g7416.t1 | NA | NA |
| chr_2 | g7416 | g7416.t1 | TTS | g7416.t1 | NA | NA |
>g7416.t1 Gene=g7416 Length=351
ATGACACAAACCGCTCGTAAATCGACTGGAGGCAAAGCACCACGTAAGCAGTTGGCCACA
AAAGCTGCTCGCAAATCAGCACCAGCAACAGGAGGTGTAAAGAAACCACATCGTTATCGT
CCAGGAACTGTCGCTCTTCGTGAAATTCGTCGCTATCAAAAATCGACAGAATTGTTGATC
CGCAAACTGCCATTCCAAACGCTTACAGTTATGGCATTGCAAGAAGCATCAGAAGCTTAC
TTGGTCGGACTCTTCGAAGACACAAACTTGTGCGCTATTCACGCTAAGCGTGTCACAATC
ATGCCTAAAGACATTCAACTCGCTCGTCGCATTCGTGGTGAACGTGCTTAA
>g7416.t1 Gene=g7416 Length=116
MTQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLI
RKLPFQTLTVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g7416.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 1 | 116 | 8.7E-57 |
| 12 | g7416.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 40 | - |
| 3 | g7416.t1 | PANTHER | PTHR11426 | HISTONE H3 | 2 | 116 | 6.1E-70 |
| 4 | g7416.t1 | PANTHER | PTHR11426:SF198 | - | 2 | 116 | 6.1E-70 |
| 6 | g7416.t1 | PRINTS | PR00622 | Histone H3 signature | 14 | 28 | 2.1E-29 |
| 5 | g7416.t1 | PRINTS | PR00622 | Histone H3 signature | 31 | 52 | 2.1E-29 |
| 7 | g7416.t1 | PRINTS | PR00622 | Histone H3 signature | 55 | 72 | 2.1E-29 |
| 1 | g7416.t1 | Pfam | PF00125 | Core histone H2A/H2B/H3/H4 | 3 | 66 | 1.2E-14 |
| 2 | g7416.t1 | Pfam | PF00125 | Core histone H2A/H2B/H3/H4 | 69 | 112 | 5.4E-20 |
| 10 | g7416.t1 | ProSitePatterns | PS00322 | Histone H3 signature 1. | 12 | 18 | - |
| 11 | g7416.t1 | SMART | SM00428 | h35 | 31 | 116 | 3.9E-51 |
| 8 | g7416.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 2 | 113 | 4.02E-44 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0000786 | nucleosome | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed