General information for g746.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g746 is located on chr_3: 5691970..5707050 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g746 | g746.t1 | isoform | g746.t1 | 5691970 | 5707050 |
| chr_3 | g746 | g746.t1 | exon | g746.t1.exon1 | 5691970 | 5692080 |
| chr_3 | g746 | g746.t1 | cds | g746.t1.CDS1 | 5691970 | 5692080 |
| chr_3 | g746 | g746.t1 | exon | g746.t1.exon2 | 5696677 | 5696839 |
| chr_3 | g746 | g746.t1 | cds | g746.t1.CDS2 | 5696677 | 5696839 |
| chr_3 | g746 | g746.t1 | exon | g746.t1.exon3 | 5707037 | 5707050 |
| chr_3 | g746 | g746.t1 | cds | g746.t1.CDS3 | 5707037 | 5707050 |
| chr_3 | g746 | g746.t1 | TSS | g746.t1 | NA | NA |
| chr_3 | g746 | g746.t1 | TTS | g746.t1 | NA | NA |
Sequences
>g746.t1 Gene=g746 Length=288
ATGGCTCTGGCAAGATTGCCGGTAGTTAACGACTGTCCGGCAGCAGGCCAAACTGCTAGA
GTTACATCCAATCTGCACTCGTCTAGTAGCAGTAGCACAATGGCAGTGAGTCGAGTGCCT
TCACCACCTCTGCCAGAAGTGAATACACCCGTCGCTGAAAATTGGTGTTATACTCAGGTC
AAAGTCGTCAAATTCAGCTATATGTGGACGATAAACAATTTTAGTTTTTGTCGAGAAGAA
ATGGGCGAAGTATTAAAATCATCCCACATTTTCAGCAGGAGCAAATGA
>g746.t1 Gene=g746 Length=95
MALARLPVVNDCPAAGQTARVTSNLHSSSSSSTMAVSRVPSPPLPEVNTPVAENWCYTQV
KVVKFSYMWTINNFSFCREEMGEVLKSSHIFSRSK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g746.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 20 | 42 | - |
| 5 | g746.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 20 | 38 | - |
| 1 | g746.t1 | PANTHER | PTHR24413 | SPECKLE-TYPE POZ PROTEIN | 35 | 92 | 4.2E-23 |
| 2 | g746.t1 | PANTHER | PTHR24413:SF91 | SPECKLE-TYPE POZ PROTEIN-LIKE | 35 | 92 | 4.2E-23 |
| 3 | g746.t1 | SUPERFAMILY | SSF49599 | TRAF domain-like | 62 | 90 | 2.83E-5 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
