| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7463 | g7463.t18 | isoform | g7463.t18 | 23884056 | 23884935 |
| chr_2 | g7463 | g7463.t18 | exon | g7463.t18.exon1 | 23884056 | 23884094 |
| chr_2 | g7463 | g7463.t18 | cds | g7463.t18.CDS1 | 23884056 | 23884094 |
| chr_2 | g7463 | g7463.t18 | exon | g7463.t18.exon2 | 23884154 | 23884511 |
| chr_2 | g7463 | g7463.t18 | cds | g7463.t18.CDS2 | 23884154 | 23884511 |
| chr_2 | g7463 | g7463.t18 | exon | g7463.t18.exon3 | 23884671 | 23884699 |
| chr_2 | g7463 | g7463.t18 | cds | g7463.t18.CDS3 | 23884671 | 23884699 |
| chr_2 | g7463 | g7463.t18 | exon | g7463.t18.exon4 | 23884764 | 23884842 |
| chr_2 | g7463 | g7463.t18 | cds | g7463.t18.CDS4 | 23884764 | 23884842 |
| chr_2 | g7463 | g7463.t18 | TTS | g7463.t18 | 23884806 | 23884806 |
| chr_2 | g7463 | g7463.t18 | exon | g7463.t18.exon5 | 23884910 | 23884935 |
| chr_2 | g7463 | g7463.t18 | cds | g7463.t18.CDS5 | 23884910 | 23884935 |
| chr_2 | g7463 | g7463.t18 | TSS | g7463.t18 | 23885222 | 23885222 |
>g7463.t18 Gene=g7463 Length=531
ATGGAATTAAATAATAATCCGATAAGAGATGAAGAGCTAGAAACAGCAATAGCCTTGGTT
CCAAAAAAAGAAGCTTCAAAAAAAGAAGAAGATTATGATCCACATAAACATCGTAATGTT
GCGCATCCAACTAGTAATTTCGATACGCTTGCACACTTGCTCAAAGGATGTTTGGGAACT
GGCATCTTAGCAATGCATGAAGCATTCAGAAATGCTGGATGGCTCAATGGTTTAATAAGT
ATGGCACTTATTGGATTTGTTTGTACATATTGTTTTCAAATTTTAATCAAGGCTCAATAT
GCCTTGTGTAAAAAACATCGTCGACCAATTTTATCTTATCCAGAGAGCATGAAGCTCGCT
CTTGAACAAGGTCCTGCTGCACTTAAATGGATTGCACCATCAGCAGTTATCGTTACAGAT
GGTTTTTTGATAATTTATCAGCTTGGTGTGTGCATTTGTTATATTGTTTTTGTCGCGGCA
AATGTTCAACTGATTGTTAAAGAATTTTATCAGTTTTATGATATTAAGTAT
>g7463.t18 Gene=g7463 Length=177
MELNNNPIRDEELETAIALVPKKEASKKEEDYDPHKHRNVAHPTSNFDTLAHLLKGCLGT
GILAMHEAFRNAGWLNGLISMALIGFVCTYCFQILIKAQYALCKKHRRPILSYPESMKLA
LEQGPAALKWIAPSAVIVTDGFLIIYQLGVCICYIVFVAANVQLIVKEFYQFYDIKY
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g7463.t18 | PANTHER | PTHR22950:SF340 | GLUTAMATE TRANSPORTER POLYPHEMUS-RELATED | 21 | 177 | 1.7E-52 |
| 3 | g7463.t18 | PANTHER | PTHR22950 | AMINO ACID TRANSPORTER | 21 | 177 | 1.7E-52 |
| 1 | g7463.t18 | Pfam | PF01490 | Transmembrane amino acid transporter protein | 43 | 170 | 1.5E-20 |
| 9 | g7463.t18 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 73 | - |
| 10 | g7463.t18 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 98 | - |
| 6 | g7463.t18 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 99 | 118 | - |
| 11 | g7463.t18 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 119 | 138 | - |
| 8 | g7463.t18 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 139 | 143 | - |
| 12 | g7463.t18 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 144 | 166 | - |
| 7 | g7463.t18 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 167 | 177 | - |
| 4 | g7463.t18 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 96 | - |
| 5 | g7463.t18 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 165 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.