| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7463 | g7463.t3 | TTS | g7463.t3 | 23882765 | 23882765 |
| chr_2 | g7463 | g7463.t3 | isoform | g7463.t3 | 23882906 | 23883632 |
| chr_2 | g7463 | g7463.t3 | exon | g7463.t3.exon1 | 23882906 | 23883103 |
| chr_2 | g7463 | g7463.t3 | cds | g7463.t3.CDS1 | 23882906 | 23883103 |
| chr_2 | g7463 | g7463.t3 | exon | g7463.t3.exon2 | 23883163 | 23883436 |
| chr_2 | g7463 | g7463.t3 | cds | g7463.t3.CDS2 | 23883163 | 23883436 |
| chr_2 | g7463 | g7463.t3 | exon | g7463.t3.exon3 | 23883500 | 23883632 |
| chr_2 | g7463 | g7463.t3 | cds | g7463.t3.CDS3 | 23883500 | 23883603 |
| chr_2 | g7463 | g7463.t3 | TSS | g7463.t3 | NA | NA |
>g7463.t3 Gene=g7463 Length=605
TATCGAAATTTGGTGTTTTAAATTCCGGCATGACAATTGTAACTATATTATACGGTTTCG
TGGGATTTTTTGGTTATTTAAAATATGGTGAAAAGTCAAAAGACAGTATCACTTTAAGTT
TACCAGCTGGACTAGTTCCAATTATCACTCAGGGATTGTTTACGTTTGCAATTTTCATAT
CTTATGCATTGCAATGTTACGTACCAATATCAATTATTTGGGAGAATTATTGCAGCGATG
AAATGAAGAAATCAAATCATAGCGATAAATACTTATTGATATTACGTCTTCTTACTACGA
TTTTTACATTTATAATAGCTGCTGCTGTTCCGCACTTGGGTCTTTTCATTTCACTTTTTG
GCGCTTTCTGTCTGTCAATTTTAGGATTAGGCTTTCCAGCTATTATGGAAATTTGTGTTT
TGTGGCCAGACAAGTTTGGCAAACTCAATTGGCATTTATGGAAGGACATTGCTTTAGTTA
TTTTTGCATTTGCTGGCTTAACGAGTGGAACATTTGCATCAATGAAAGATATAATTGCCA
CATTCTCAACAGATGCATCTGAAGTAGCAAAAACTTTTACCAATGCTACAATTGAGCAAT
CTTAG
>g7463.t3 Gene=g7463 Length=191
MTIVTILYGFVGFFGYLKYGEKSKDSITLSLPAGLVPIITQGLFTFAIFISYALQCYVPI
SIIWENYCSDEMKKSNHSDKYLLILRLLTTIFTFIIAAAVPHLGLFISLFGAFCLSILGL
GFPAIMEICVLWPDKFGKLNWHLWKDIALVIFAFAGLTSGTFASMKDIIATFSTDASEVA
KTFTNATIEQS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g7463.t3 | PANTHER | PTHR22950:SF340 | GLUTAMATE TRANSPORTER POLYPHEMUS-RELATED | 1 | 172 | 7.4E-50 |
| 3 | g7463.t3 | PANTHER | PTHR22950 | AMINO ACID TRANSPORTER | 1 | 172 | 7.4E-50 |
| 1 | g7463.t3 | Pfam | PF01490 | Transmembrane amino acid transporter protein | 1 | 163 | 9.4E-24 |
| 11 | g7463.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 37 | - |
| 14 | g7463.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 38 | 60 | - |
| 9 | g7463.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 61 | 80 | - |
| 15 | g7463.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 81 | 100 | - |
| 12 | g7463.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 101 | 105 | - |
| 16 | g7463.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 106 | 131 | - |
| 10 | g7463.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 132 | 142 | - |
| 17 | g7463.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 163 | - |
| 13 | g7463.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 164 | 191 | - |
| 6 | g7463.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 2 | 17 | - |
| 4 | g7463.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 32 | 54 | - |
| 5 | g7463.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 82 | 104 | - |
| 7 | g7463.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 109 | 131 | - |
| 8 | g7463.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 165 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.