| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g75 | g75.t1 | TTS | g75.t1 | 624968 | 624968 |
| chr_3 | g75 | g75.t1 | isoform | g75.t1 | 625045 | 628489 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon1 | 625045 | 625274 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS1 | 625045 | 625274 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon2 | 625334 | 625494 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS2 | 625334 | 625494 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon3 | 625608 | 625729 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS3 | 625608 | 625729 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon4 | 625789 | 625846 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS4 | 625789 | 625846 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon5 | 625901 | 626029 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS5 | 625901 | 626029 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon6 | 626085 | 626147 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS6 | 626085 | 626147 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon7 | 626206 | 626325 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS7 | 626206 | 626325 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon8 | 626390 | 626567 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS8 | 626390 | 626567 |
| chr_3 | g75 | g75.t1 | exon | g75.t1.exon9 | 628414 | 628489 |
| chr_3 | g75 | g75.t1 | cds | g75.t1.CDS9 | 628414 | 628489 |
| chr_3 | g75 | g75.t1 | TSS | g75.t1 | 628571 | 628571 |
>g75.t1 Gene=g75 Length=1137
ATGAGTCCGAACAGTGAAAATGATGTAGTAGATAAAGTTAATGGAGATCTAAATGGTGAT
AGTGAAACTAAAAATGGCCACATTGATGATCATGGTCCACTGAGTGTTCCTGAACCGGAC
TACAAACTCGTTCTCAAATGGAGAAATATTTTGGCTTTTATTTATCTTCACGCATTCACG
ATCGTTTCTTTCTTTTATCCTCCGGTATGTTTATCAACTTACATTTACCAGTTTTTCCTA
GCAGTTTTTATTGGATTTGGCACAACAGCCGGTTCACATAGGCTTTTTACACATCGAAGT
TATCGCGCTAAACCGCTTCTACGATGGTTCATTATTTACTTGCAGACACTGGCTGGCCAA
GAGCCTATTTACAGATGGGTTCGTGATCATCGTGTTCATCATAAATTTACAGATACAAAT
GCAGATCCACATAATTCAAAACGAGGATTTTTCTTCTCACACATGGGTTGGTTATGTTGC
AAAAAACATCCTGATGTTTATAAATATGGAAAGAAAATTGACATGAGTGACTTAGATGAT
GACAAAGTTATTCAATTCCAGAGAAAAATTTACACACCTGCCACATTTTTCTGTTCACTT
ATTCTTCCAACTTTAATTACAATGGCAATGGGTGAACATTGGTGGCCTTCATGGAATTTT
AATGTTGCCCGTTATACAATTGGTCTTCATTTAGTATGGCTTGTAAATTCTGGAGCTCAT
TATTGGGGAAAACGACCTTATGAAAAAAATATTTCAGCATCAGATTCATATATTGTTGCA
ACGCTTGCTTTAGGTGAAGGATGGCATAACTATCATCATGTTTATCCATGGGATTACAAA
ACAGCTGAAAGCACAAGATATTGGTTCAATCCAACTCTCCTATTTATTGATGTTGCTGCT
AAACTTGGTCTCGCAACAGATCTTAAAGTAGCTTCGGATGAAATGATTAGAGCTCGCGTG
CTAAGAACTGGTGATGGTAGTCATAAATATTCAAAACAAGCTCTAATTGATGCTGAAAAT
CCTTTGGATAATAATAATTATGACTGCACTATGGACCATCTTTGGGGCTTTGGAGACAAA
GCAATGACAGAAACTGACATGAAAAATATCGTCATTCACAATCGGGAAGTTGATTAA
>g75.t1 Gene=g75 Length=378
MSPNSENDVVDKVNGDLNGDSETKNGHIDDHGPLSVPEPDYKLVLKWRNILAFIYLHAFT
IVSFFYPPVCLSTYIYQFFLAVFIGFGTTAGSHRLFTHRSYRAKPLLRWFIIYLQTLAGQ
EPIYRWVRDHRVHHKFTDTNADPHNSKRGFFFSHMGWLCCKKHPDVYKYGKKIDMSDLDD
DKVIQFQRKIYTPATFFCSLILPTLITMAMGEHWWPSWNFNVARYTIGLHLVWLVNSGAH
YWGKRPYEKNISASDSYIVATLALGEGWHNYHHVYPWDYKTAESTRYWFNPTLLFIDVAA
KLGLATDLKVASDEMIRARVLRTGDGSHKYSKQALIDAENPLDNNNYDCTMDHLWGFGDK
AMTETDMKNIVIHNREVD
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 24 | g75.t1 | CDD | cd03505 | Delta9-FADS-like | 78 | 309 | 4.76491E-68 |
| 2 | g75.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 43 | 344 | 4.3E-106 |
| 3 | g75.t1 | PANTHER | PTHR11351:SF31 | RE43130P | 43 | 344 | 4.3E-106 |
| 6 | g75.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 47 | 67 | 4.0E-48 |
| 8 | g75.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 70 | 92 | 4.0E-48 |
| 10 | g75.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 93 | 113 | 4.0E-48 |
| 7 | g75.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 130 | 159 | 4.0E-48 |
| 4 | g75.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 191 | 209 | 4.0E-48 |
| 5 | g75.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 222 | 243 | 4.0E-48 |
| 9 | g75.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 265 | 279 | 4.0E-48 |
| 1 | g75.t1 | Pfam | PF00487 | Fatty acid desaturase | 78 | 276 | 1.6E-14 |
| 17 | g75.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 49 | - |
| 21 | g75.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 69 | - |
| 19 | g75.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 70 | 74 | - |
| 22 | g75.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 75 | 96 | - |
| 15 | g75.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 97 | 189 | - |
| 20 | g75.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 190 | 210 | - |
| 18 | g75.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 211 | 221 | - |
| 23 | g75.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 222 | 242 | - |
| 16 | g75.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 243 | 378 | - |
| 12 | g75.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 69 | - |
| 13 | g75.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 96 | - |
| 14 | g75.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 190 | 211 | - |
| 11 | g75.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 243 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed