General information for g7642.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g7642 is located on chr_2: 25044744..25047680 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7642 | g7642.t3 | TSS | g7642.t3 | 25044705 | 25044705 |
| chr_2 | g7642 | g7642.t3 | isoform | g7642.t3 | 25044744 | 25046251 |
| chr_2 | g7642 | g7642.t3 | exon | g7642.t3.exon1 | 25044744 | 25045067 |
| chr_2 | g7642 | g7642.t3 | cds | g7642.t3.CDS1 | 25044744 | 25045067 |
| chr_2 | g7642 | g7642.t3 | exon | g7642.t3.exon2 | 25046245 | 25046251 |
| chr_2 | g7642 | g7642.t3 | cds | g7642.t3.CDS2 | 25046245 | 25046250 |
| chr_2 | g7642 | g7642.t3 | TTS | g7642.t3 | NA | NA |
Sequences
>g7642.t3 Gene=g7642 Length=331
ATGATTAAAAGTGTATTTTTAATTTTTTTAATTGTGAGAATTGCACAAACACACATTGTT
GAGATTGAAAATGGAAAAATTATTGGTGCAGAATATAACGACTACTATGCATATCGAGGT
TTAAGATATGCAAAAGCGCAGAGATTCAGGATTGCTAAACCATATGAAGAAAAGTGGAAT
GACACAAAAGAATTTTTCAATTATGGTCATGAATGCGCTCAGTATGATCATCTTACTTAT
ACATATGTTGGACAAGAAGATTGTCTTTTTTTAAATGTATTCCTTCCAAAAAGTGTTATT
AATTCAAAAGAACCTGTGCCTGTGGTTGCAT
>g7642.t3 Gene=g7642 Length=110
MIKSVFLIFLIVRIAQTHIVEIENGKIIGAEYNDYYAYRGLRYAKAQRFRIAKPYEEKWN
DTKEFFNYGHECAQYDHLTYTYVGQEDCLFLNVFLPKSVINSKEPVPVVA
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g7642.t3 | Gene3D | G3DSA:3.40.50.1820 | - | 10 | 110 | 1.8E-21 |
| 1 | g7642.t3 | Pfam | PF00135 | Carboxylesterase family | 17 | 109 | 8.4E-17 |
| 7 | g7642.t3 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 17 | - |
| 8 | g7642.t3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 9 | g7642.t3 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 12 | - |
| 10 | g7642.t3 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 13 | 17 | - |
| 6 | g7642.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 18 | 110 | - |
| 3 | g7642.t3 | ProSitePatterns | PS00941 | Carboxylesterases type-B signature 2. | 86 | 96 | - |
| 2 | g7642.t3 | SUPERFAMILY | SSF53474 | alpha/beta-Hydrolases | 17 | 109 | 1.44E-18 |
| 4 | g7642.t3 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 17 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
