| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7682 | g7682.t3 | TTS | g7682.t3 | 25237172 | 25237172 |
| chr_2 | g7682 | g7682.t3 | isoform | g7682.t3 | 25237395 | 25238121 |
| chr_2 | g7682 | g7682.t3 | exon | g7682.t3.exon1 | 25237395 | 25237662 |
| chr_2 | g7682 | g7682.t3 | cds | g7682.t3.CDS1 | 25237395 | 25237662 |
| chr_2 | g7682 | g7682.t3 | exon | g7682.t3.exon2 | 25237716 | 25238041 |
| chr_2 | g7682 | g7682.t3 | cds | g7682.t3.CDS2 | 25237716 | 25237822 |
| chr_2 | g7682 | g7682.t3 | exon | g7682.t3.exon3 | 25238110 | 25238121 |
| chr_2 | g7682 | g7682.t3 | TSS | g7682.t3 | NA | NA |
>g7682.t3 Gene=g7682 Length=606
GCTGTGGCAGTCACATTTGGAAATAAAATATTTGGCTCACTCGCATGGCTGATTCCAATA
TTTGTTGCTTTATCAACATTTGGTGGAGTGAATGGTGTGATTTTTACAAGTGCACGACTC
TTCGCCACTGGTGCCAATGAAGGTCATCTTCCATCATTTTTTGCCCTTTTCCATGTCACC
AAACAGACGCCAATTCCATCACTCATCTTTTCTTGTCTCGTCTCACTTATTATGATAATG
TTTGGAAATGCATTCGAGTTAGTCAACTATTTCAGTCAAGCACTTTGGTTATCAATTGCT
GCATGCGTTGGCGGACTTATTTGGATGCGAAAAACAAAACCAGACGCGCCAAGACCAATT
AAAGTCAACATAATCATTCCATGGATTTTTCTTATCATTTGCCTTGGTCTTGTTCTAACT
CCATCATTCACTGAACCTATGAATTTGGCTATAAATATTCTAATTACACTCAGTGGTGTT
CCATTTTATTTCTTATGTGTCAAATGGAAAAATAAACCAGCTGCATATAAGAAAGTCTCA
AAGAGTGTCGAGAAATTTTGCCAAATTTTATTCTCATCAGTATTCATTGACGAAGAATCT
CATTAG
>g7682.t3 Gene=g7682 Length=124
MIMFGNAFELVNYFSQALWLSIAACVGGLIWMRKTKPDAPRPIKVNIIIPWIFLIICLGL
VLTPSFTEPMNLAINILITLSGVPFYFLCVKWKNKPAAYKKVSKSVEKFCQILFSSVFID
EESH
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g7682.t3 | PANTHER | PTHR11785:SF527 | AMINO ACID TRANSPORTER PROTEIN JHI-21 | 1 | 121 | 2.6E-38 |
| 2 | g7682.t3 | PANTHER | PTHR11785 | AMINO ACID TRANSPORTER | 1 | 121 | 2.6E-38 |
| 9 | g7682.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 12 | - |
| 11 | g7682.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 31 | - |
| 6 | g7682.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 32 | 42 | - |
| 12 | g7682.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 43 | 66 | - |
| 8 | g7682.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 67 | 71 | - |
| 10 | g7682.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 72 | 90 | - |
| 7 | g7682.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 91 | 124 | - |
| 5 | g7682.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 10 | 32 | - |
| 4 | g7682.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 45 | 67 | - |
| 3 | g7682.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 72 | 90 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.