Gene loci information

Transcript annotation

  • This transcript has been annotated as Y+L amino acid transporter 2.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g7682 g7682.t7 TTS g7682.t7 25237172 25237172
chr_2 g7682 g7682.t7 isoform g7682.t7 25238039 25240097
chr_2 g7682 g7682.t7 exon g7682.t7.exon1 25238039 25238041
chr_2 g7682 g7682.t7 cds g7682.t7.CDS1 25238039 25238041
chr_2 g7682 g7682.t7 exon g7682.t7.exon2 25238110 25238233
chr_2 g7682 g7682.t7 cds g7682.t7.CDS2 25238110 25238233
chr_2 g7682 g7682.t7 exon g7682.t7.exon3 25238291 25238661
chr_2 g7682 g7682.t7 cds g7682.t7.CDS3 25238291 25238661
chr_2 g7682 g7682.t7 exon g7682.t7.exon4 25239102 25239217
chr_2 g7682 g7682.t7 cds g7682.t7.CDS4 25239102 25239217
chr_2 g7682 g7682.t7 exon g7682.t7.exon5 25239286 25239365
chr_2 g7682 g7682.t7 cds g7682.t7.CDS5 25239286 25239365
chr_2 g7682 g7682.t7 exon g7682.t7.exon6 25239881 25239926
chr_2 g7682 g7682.t7 cds g7682.t7.CDS6 25239881 25239926
chr_2 g7682 g7682.t7 exon g7682.t7.exon7 25240010 25240097
chr_2 g7682 g7682.t7 cds g7682.t7.CDS7 25240010 25240097
chr_2 g7682 g7682.t7 TSS g7682.t7 25240452 25240452

Sequences

>g7682.t7 Gene=g7682 Length=828
ATGGGTGAAGATAGCAATAATAAAGTTGTACTTGAACGTAAAATTACGCTATGGAATGGT
GTGGGAATAATTGTTGGATCTATAATCGGATCGGGCATCTTTTTGTCACCAGCTGGAGTC
TATACTTATACTGAATCAGTAGGCTTCTCTCTCGTTGTCTGGTGCCTTTCAGGTGTACTC
TCAACTCTCGGAGCTCTCTGTTATGCAGAATTGGGCGTATTAATCACAAGATCGGGCGGT
GATTACGCTTATTTACTTGAGGCTTTTGGACCTCTAGTTGGTTTTCTTCGTTTGTGGATT
GCTCTTTTTATCATTCGACCAACTACTCAGGCGATTGTTGCGCTCACATTTGCAGAATAT
GCTGCGAAGCCCTTCTTTCCAAACTGTGTGATTCCACAAGATTTAATTAAGTTGCTCGGA
GCAATTTGCCTCTGTCTACTAACAGCAATCAACTGCATATCGACAAAGCTGTCAATGAAA
GTTCAAGATATTTTCACAGCTGGTAAATTAATTGCTTTAATATCGATCATTGCTATGGGA
GTTTATGGAATGATTATCAGCGACACAAACAACTTTGATGATGCTTGGTCAGGAGATTAT
GATGCAAAGAAAATTTGTTATGCTTTCATGCAGGGATTATTTGCCTTCGGAGGATGGAAT
TATTTGAATTTTGTTACTGGTGAATTACAGGATCCTTACAAAAATTTACCGCGTGCAATT
TACATTGGCATGCCAATTGTGACGATAATATACTGTCTTACAAACTTAGCTTATTTTGCG
GTATTGACTGGTGCAGAAATGAAAGCTAGCATCGCTGTGGCAGTCACA

>g7682.t7 Gene=g7682 Length=276
MGEDSNNKVVLERKITLWNGVGIIVGSIIGSGIFLSPAGVYTYTESVGFSLVVWCLSGVL
STLGALCYAELGVLITRSGGDYAYLLEAFGPLVGFLRLWIALFIIRPTTQAIVALTFAEY
AAKPFFPNCVIPQDLIKLLGAICLCLLTAINCISTKLSMKVQDIFTAGKLIALISIIAMG
VYGMIISDTNNFDDAWSGDYDAKKICYAFMQGLFAFGGWNYLNFVTGELQDPYKNLPRAI
YIGMPIVTIIYCLTNLAYFAVLTGAEMKASIAVAVT

Protein features from InterProScan

Transcript Database ID Name Start End E.value
11 g7682.t7 Gene3D G3DSA:1.20.1740.10 - 10 276 4.3E-62
2 g7682.t7 PANTHER PTHR11785:SF527 AMINO ACID TRANSPORTER PROTEIN JHI-21 3 276 4.6E-138
3 g7682.t7 PANTHER PTHR11785 AMINO ACID TRANSPORTER 3 276 4.6E-138
1 g7682.t7 Pfam PF13520 Amino acid permease 15 270 2.0E-38
15 g7682.t7 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 14 -
20 g7682.t7 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 15 35 -
18 g7682.t7 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 36 46 -
24 g7682.t7 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 47 71 -
12 g7682.t7 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 72 82 -
26 g7682.t7 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 83 105 -
16 g7682.t7 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 106 134 -
25 g7682.t7 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 135 154 -
13 g7682.t7 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 155 165 -
22 g7682.t7 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 166 187 -
17 g7682.t7 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 188 206 -
21 g7682.t7 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 207 227 -
14 g7682.t7 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 228 238 -
23 g7682.t7 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 239 261 -
19 g7682.t7 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 262 276 -
10 g7682.t7 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 21 43 -
7 g7682.t7 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 53 75 -
5 g7682.t7 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 82 104 -
9 g7682.t7 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 130 152 -
8 g7682.t7 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 165 187 -
4 g7682.t7 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 207 226 -
6 g7682.t7 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 239 261 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0016020 membrane CC
GO:0055085 transmembrane transport BP
GO:0022857 transmembrane transporter activity MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values