| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7730 | g7730.t1 | TTS | g7730.t1 | 25590078 | 25590078 |
| chr_2 | g7730 | g7730.t1 | isoform | g7730.t1 | 25590195 | 25590724 |
| chr_2 | g7730 | g7730.t1 | exon | g7730.t1.exon1 | 25590195 | 25590350 |
| chr_2 | g7730 | g7730.t1 | cds | g7730.t1.CDS1 | 25590195 | 25590350 |
| chr_2 | g7730 | g7730.t1 | exon | g7730.t1.exon2 | 25590415 | 25590496 |
| chr_2 | g7730 | g7730.t1 | cds | g7730.t1.CDS2 | 25590415 | 25590496 |
| chr_2 | g7730 | g7730.t1 | exon | g7730.t1.exon3 | 25590552 | 25590724 |
| chr_2 | g7730 | g7730.t1 | cds | g7730.t1.CDS3 | 25590552 | 25590724 |
| chr_2 | g7730 | g7730.t1 | TSS | g7730.t1 | 25590803 | 25590803 |
>g7730.t1 Gene=g7730 Length=411
ATGCTTAGAAACATTGCAAAATTAAATATTACAAGAGCGATCATTAGTTCAGCACAAAGA
AATGTTTCAACATCATCGAGATTGTTTGATATTTTCAAAGTGCAAGATGAGAAAGATTTT
GAGGAGAGAGTACTAAAATCTAAAAATGTTGTAGTCGTCGATTTCATGGCAACTTGGTGC
AATCCGTGCAAAATGTTAGGACCGAGGATAGAAAAAGTCGTAGAAGAGAACAAAGGAAAG
GTGTCATTAGCAAAAGTCGATATTGATGAGCTAACTGATCTTTCACTTGAATATGGTGTT
CAGGCAGTTCCCGTATTAGCAATCATTAAGGATGGAAAGGTTCAAAAACAACTAATAGGT
CTACAAGACGTTGATGTTATCAGAAAATTTGTTAAGAGCAGCATCGAGTAG
>g7730.t1 Gene=g7730 Length=136
MLRNIAKLNITRAIISSAQRNVSTSSRLFDIFKVQDEKDFEERVLKSKNVVVVDFMATWC
NPCKMLGPRIEKVVEENKGKVSLAKVDIDELTDLSLEYGVQAVPVLAIIKDGKVQKQLIG
LQDVDVIRKFVKSSIE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g7730.t1 | CDD | cd02947 | TRX_family | 38 | 132 | 0.00000 |
| 8 | g7730.t1 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 18 | 135 | 0.00000 |
| 2 | g7730.t1 | PANTHER | PTHR43601:SF3 | THIOREDOXIN, MITOCHONDRIAL | 30 | 130 | 0.00000 |
| 3 | g7730.t1 | PANTHER | PTHR43601 | THIOREDOXIN, MITOCHONDRIAL | 30 | 130 | 0.00000 |
| 5 | g7730.t1 | PRINTS | PR00421 | Thioredoxin family signature | 51 | 59 | 0.00001 |
| 6 | g7730.t1 | PRINTS | PR00421 | Thioredoxin family signature | 59 | 68 | 0.00001 |
| 4 | g7730.t1 | PRINTS | PR00421 | Thioredoxin family signature | 99 | 110 | 0.00001 |
| 1 | g7730.t1 | Pfam | PF00085 | Thioredoxin | 34 | 132 | 0.00000 |
| 10 | g7730.t1 | ProSiteProfiles | PS51352 | Thioredoxin domain profile. | 23 | 136 | 13.05100 |
| 7 | g7730.t1 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 33 | 134 | 0.00000 |
| 11 | g7730.t1 | TIGRFAM | TIGR01068 | thioredoxin: thioredoxin | 36 | 133 | 0.00000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0015035 | protein-disulfide reductase activity | MF |
| GO:0006662 | glycerol ether metabolic process | BP |
| GO:0045454 | cell redox homeostasis | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.