| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7730 | g7730.t5 | TTS | g7730.t5 | 25590078 | 25590078 |
| chr_2 | g7730 | g7730.t5 | isoform | g7730.t5 | 25590195 | 25590951 |
| chr_2 | g7730 | g7730.t5 | exon | g7730.t5.exon1 | 25590195 | 25590350 |
| chr_2 | g7730 | g7730.t5 | cds | g7730.t5.CDS1 | 25590195 | 25590350 |
| chr_2 | g7730 | g7730.t5 | exon | g7730.t5.exon2 | 25590430 | 25590496 |
| chr_2 | g7730 | g7730.t5 | cds | g7730.t5.CDS2 | 25590430 | 25590496 |
| chr_2 | g7730 | g7730.t5 | exon | g7730.t5.exon3 | 25590552 | 25590801 |
| chr_2 | g7730 | g7730.t5 | cds | g7730.t5.CDS3 | 25590552 | 25590724 |
| chr_2 | g7730 | g7730.t5 | exon | g7730.t5.exon4 | 25590863 | 25590951 |
| chr_2 | g7730 | g7730.t5 | TSS | g7730.t5 | NA | NA |
>g7730.t5 Gene=g7730 Length=562
TTTTGAAAGTTCAATTGTTGTCATTTCTTAAAGCTTATTTTAAATTGTATTAGAAGCTTT
TATCTAAAAGAAAAAGTTTTAATCATATTGAAAATAGAAATAGAAAATTTTCATCAAAAA
CAAAATAAGTTATAATTGTAAAATTTTAGCCATTTAAATTATCAAGATGCTTAGAAACAT
TGCAAAATTAAATATTACAAGAGCGATCATTAGTTCAGCACAAAGAAATGTTTCAACATC
ATCGAGATTGTTTGATATTTTCAAAGTGCAAGATGAGAAAGATTTTGAGGAGAGAGTACT
AAAATCTAAAAATGTTGTAGTCGTCGATTTCATGGCAACTTGGTGCAATCCGTGCAAAAT
GTTAGGACCGAGGATAGAAAAAGTCGTAGAAGAGAACAAAGGAAAGGTCGATATTGATGA
GCTAACTGATCTTTCACTTGAATATGGTGTTCAGGCAGTTCCCGTATTAGCAATCATTAA
GGATGGAAAGGTTCAAAAACAACTAATAGGTCTACAAGACGTTGATGTTATCAGAAAATT
TGTTAAGAGCAGCATCGAGTAG
>g7730.t5 Gene=g7730 Length=131
MLRNIAKLNITRAIISSAQRNVSTSSRLFDIFKVQDEKDFEERVLKSKNVVVVDFMATWC
NPCKMLGPRIEKVVEENKGKVDIDELTDLSLEYGVQAVPVLAIIKDGKVQKQLIGLQDVD
VIRKFVKSSIE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g7730.t5 | CDD | cd02947 | TRX_family | 38 | 127 | 0.0000000 |
| 8 | g7730.t5 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 18 | 130 | 0.0000000 |
| 2 | g7730.t5 | PANTHER | PTHR43601:SF3 | THIOREDOXIN, MITOCHONDRIAL | 30 | 125 | 0.0000000 |
| 3 | g7730.t5 | PANTHER | PTHR43601 | THIOREDOXIN, MITOCHONDRIAL | 30 | 125 | 0.0000000 |
| 5 | g7730.t5 | PRINTS | PR00421 | Thioredoxin family signature | 51 | 59 | 0.0000097 |
| 6 | g7730.t5 | PRINTS | PR00421 | Thioredoxin family signature | 59 | 68 | 0.0000097 |
| 4 | g7730.t5 | PRINTS | PR00421 | Thioredoxin family signature | 94 | 105 | 0.0000097 |
| 1 | g7730.t5 | Pfam | PF00085 | Thioredoxin | 34 | 127 | 0.0000000 |
| 9 | g7730.t5 | ProSiteProfiles | PS51352 | Thioredoxin domain profile. | 23 | 131 | 10.0330000 |
| 7 | g7730.t5 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 33 | 129 | 0.0000000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.