| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7731 | g7731.t2 | TSS | g7731.t2 | 25591251 | 25591251 |
| chr_2 | g7731 | g7731.t2 | isoform | g7731.t2 | 25591504 | 25592591 |
| chr_2 | g7731 | g7731.t2 | exon | g7731.t2.exon1 | 25591504 | 25591552 |
| chr_2 | g7731 | g7731.t2 | exon | g7731.t2.exon2 | 25591699 | 25591797 |
| chr_2 | g7731 | g7731.t2 | cds | g7731.t2.CDS1 | 25591757 | 25591797 |
| chr_2 | g7731 | g7731.t2 | exon | g7731.t2.exon3 | 25591922 | 25592043 |
| chr_2 | g7731 | g7731.t2 | cds | g7731.t2.CDS2 | 25591922 | 25592043 |
| chr_2 | g7731 | g7731.t2 | exon | g7731.t2.exon4 | 25592118 | 25592314 |
| chr_2 | g7731 | g7731.t2 | cds | g7731.t2.CDS3 | 25592118 | 25592314 |
| chr_2 | g7731 | g7731.t2 | exon | g7731.t2.exon5 | 25592460 | 25592591 |
| chr_2 | g7731 | g7731.t2 | cds | g7731.t2.CDS4 | 25592460 | 25592591 |
| chr_2 | g7731 | g7731.t2 | TTS | g7731.t2 | NA | NA |
>g7731.t2 Gene=g7731 Length=599
ATGGAAAGCACACCCGAATGCAGAATATGTCGAACGGAAGCAACAGCAGACCGTCCACTA
TTTTTTCCATGCATATGTACAGGCAGTATCAAATACATTCATCAAGAATGTTTATTGCAA
TGGATGAGATACAGCAGAAAAGAAGTACTTTTACACCGATTTATTCTCCAGATATGCCGA
AAGTCTTGCCTCTTCGTGTGGTAGCTGGTGGTCTGTTAAGTTCGATAGCTACAGCTGTGA
AATATTGGCTTCATTACACATTAGTTGCTGTTGCATGGCTTGGTATTGTCCCTCTCACTG
CTTATCGCACATATCGATTTTTCTTTTCCGGATCGCTTGATATGCTAGTTTCACTTCCAT
TCGATATGTTTTCAACAGAGAATTTAGCTGCTGATGTCTTTCGTGGTTGTTTTGTTGTCA
CATGTACATTATTTGCTTTCATTGGTTTAGTGTGGCTAAGAGAGCAGATTCTTCATGGAG
GTGGACCAGATTGGTTAGAAAGAGATGAAGGAAACAATGTTAATGAAGATATTCCAAGAG
CTGCACCACCACCACAAGCAGATAATTTACAGGAACCACTTGATGATGAAAATGGCAAT
>g7731.t2 Gene=g7731 Length=164
MFIAMDEIQQKRSTFTPIYSPDMPKVLPLRVVAGGLLSSIATAVKYWLHYTLVAVAWLGI
VPLTAYRTYRFFFSGSLDMLVSLPFDMFSTENLAADVFRGCFVVTCTLFAFIGLVWLREQ
ILHGGGPDWLERDEGNNVNEDIPRAAPPPQADNLQEPLDDENGN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g7731.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 133 | 164 | - |
| 1 | g7731.t2 | PANTHER | PTHR13145:SF0 | E3 UBIQUITIN-PROTEIN LIGASE MARCH6 | 10 | 157 | 3.2E-46 |
| 2 | g7731.t2 | PANTHER | PTHR13145 | SSM4 PROTEIN | 10 | 157 | 3.2E-46 |
| 8 | g7731.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 26 | - |
| 12 | g7731.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 27 | 48 | - |
| 7 | g7731.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 49 | 54 | - |
| 10 | g7731.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 55 | 77 | - |
| 9 | g7731.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 78 | 96 | - |
| 11 | g7731.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 97 | 117 | - |
| 6 | g7731.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 118 | 164 | - |
| 4 | g7731.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 47 | 69 | - |
| 3 | g7731.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 117 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed