General information for g7755.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Mucolipin-3.
Parent gene
- The parent gene g7755 is located on chr_2: 25798764..25801421 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7755 | g7755.t3 | isoform | g7755.t3 | 25798764 | 25799530 |
| chr_2 | g7755 | g7755.t3 | exon | g7755.t3.exon1 | 25798764 | 25799530 |
| chr_2 | g7755 | g7755.t3 | cds | g7755.t3.CDS1 | 25798766 | 25799428 |
| chr_2 | g7755 | g7755.t3 | TSS | g7755.t3 | NA | NA |
| chr_2 | g7755 | g7755.t3 | TTS | g7755.t3 | NA | NA |
Sequences
>g7755.t3 Gene=g7755 Length=767
ATCAAAACTGTGAATTTAAAAGCAAGTGGCCCAATTTCTGCACCTGATTGCTATAAATTC
AAAGTTTTTATTACATTTGATAACACTGACCACGATGGTCAAATGATTCTACAATTAGAC
GCCATTCCTGTGAGATTAGTTTGCAGAGGAGATACGCAATTTATTACGAATAGTAAAATT
GATGCAGCGCTTCGATCAGTTTTGAACGTGTTTGTCATCATAATTTGTGCAATTTCGCTT
GCACTATGCAGTCGTGCAATCTTTCGTGCACAACTGTTGAGAATTAAAACTGATGAATTT
TTCATTCAAGTATTTGGACGTGAGTTGAGTTCAAAAGGTCGATGGGAATTTGTAAATATG
TGGTATATTATGATTTGCGTTAATGACGTATTATTAATCCTCGGTTCAGCTATAAAGGAG
CAAATTGAACGAAAACATTTTGAGGCAGATGAGTGGAACAATTGTTCATTATTGCTTGGT
ATAGGCAATCTACTTGTATGGTTTGGCGTGCTGCGTTATCTTGGATTTTTCAGAACATAC
AACGTCGTTATTTTGACACTACAAAAGGCGCTGCCACATATCGGACGGTTCCTATTATGT
GCTCTTCTTATCTATGCGGGTTTCACATTCTGCGGGTGGCTGATTCTCGGTCCCTATCAC
ATAAAATTCCGATCACTTTCAACAACTTCTGAATGTCTCTTTGCATTGATCAATGGTGAT
GATATGTTTGCGACGTTCAGCATAATGTCAGATAAATCAATGACGCT
>g7755.t3 Gene=g7755 Length=221
MILQLDAIPVRLVCRGDTQFITNSKIDAALRSVLNVFVIIICAISLALCSRAIFRAQLLR
IKTDEFFIQVFGRELSSKGRWEFVNMWYIMICVNDVLLILGSAIKEQIERKHFEADEWNN
CSLLLGIGNLLVWFGVLRYLGFFRTYNVVILTLQKALPHIGRFLLCALLIYAGFTFCGWL
ILGPYHIKFRSLSTTSECLFALINGDDMFATFSIMSDKSMT
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g7755.t3 | PANTHER | PTHR12127 | MUCOLIPIN | 23 | 220 | 3.4E-75 |
| 1 | g7755.t3 | Pfam | PF08016 | Polycystin cation channel | 124 | 212 | 5.3E-6 |
| 8 | g7755.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 32 | - |
| 15 | g7755.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 33 | 54 | - |
| 11 | g7755.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 55 | 82 | - |
| 12 | g7755.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 100 | - |
| 9 | g7755.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 101 | 120 | - |
| 14 | g7755.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 121 | 140 | - |
| 10 | g7755.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 141 | 159 | - |
| 13 | g7755.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 160 | 182 | - |
| 7 | g7755.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 183 | 221 | - |
| 3 | g7755.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 32 | 54 | - |
| 5 | g7755.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 105 | - |
| 6 | g7755.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 118 | 140 | - |
| 4 | g7755.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 160 | 182 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005261 | cation channel activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
