General information for g7758.t6
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Zinc transporter ZIP11.
Parent gene
- The parent gene g7758 is located on chr_2: 25830558..25832183 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7758 | g7758.t6 | isoform | g7758.t6 | 25830558 | 25832183 |
| chr_2 | g7758 | g7758.t6 | exon | g7758.t6.exon1 | 25830558 | 25830748 |
| chr_2 | g7758 | g7758.t6 | cds | g7758.t6.CDS1 | 25830560 | 25830748 |
| chr_2 | g7758 | g7758.t6 | exon | g7758.t6.exon2 | 25830813 | 25831004 |
| chr_2 | g7758 | g7758.t6 | cds | g7758.t6.CDS2 | 25830813 | 25831004 |
| chr_2 | g7758 | g7758.t6 | exon | g7758.t6.exon3 | 25831062 | 25831205 |
| chr_2 | g7758 | g7758.t6 | cds | g7758.t6.CDS3 | 25831062 | 25831169 |
| chr_2 | g7758 | g7758.t6 | exon | g7758.t6.exon4 | 25832033 | 25832183 |
| chr_2 | g7758 | g7758.t6 | TSS | g7758.t6 | 25832182 | 25832182 |
| chr_2 | g7758 | g7758.t6 | TTS | g7758.t6 | NA | NA |
Sequences
>g7758.t6 Gene=g7758 Length=678
AGTCAGTGTGGGCTAAGAAGAATTGAAATATTTGGTTTGCATTATTTTTAATCATTTTCT
ATTGATAAACATGAACAACGCAACTTAATTGTACAATTTGGTTAAATTTAAAAGCAAACA
CATCGTGACAACGAGCACAAATTTGCCAAAGGCATAAGAGATAAAATAAAGTACTTAGAC
AGTCAAAATGATTGAGGGATACAATGCTGTTACACAAGCTTTGCTTGGCACACTTCTGAC
ATGGGGATTGACTGCTGCTGGCGCTGGTCTAGTCATTTTTCTACGCGGTAATCACAGAAA
AACACTCGATGCATCATTAGGATTTAGTGCTGGTGTTATGGTTGCTGCTAGTTTTTGGTC
ATTACTTGCACCTGCAATTGAACTGGCAGAATCAAGTGGTGATTATGGAAGTGAGGGACA
ATTTGCATTTGTTCCAGTCGCAGCTGGATTTCTTTTTGGTGCAATTTTTGTATATGCGAC
AGATAGAGTCATAACGTATTTGGGTATAAATTCAGCATCAATGATGATTCAATTAACGCA
ATCAAATAAAGACAAAGCTGACATAGCGATGGATGAATGTGCCTTGGAGCATGGCAAGCC
AATGATTGCAGTAGGGGCACTTAATGAGCATTCAACGACAATTGGTATGGACAGTTTTGC
TGATTGCTTAAATAATCA
>g7758.t6 Gene=g7758 Length=163
MIEGYNAVTQALLGTLLTWGLTAAGAGLVIFLRGNHRKTLDASLGFSAGVMVAASFWSLL
APAIELAESSGDYGSEGQFAFVPVAAGFLFGAIFVYATDRVITYLGINSASMMIQLTQSN
KDKADIAMDECALEHGKPMIAVGALNEHSTTIGMDSFADCLNN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g7758.t6 | PANTHER | PTHR11040:SF127 | ZINC TRANSPORTER ZIP11 | 13 | 130 | 4.8E-20 |
| 2 | g7758.t6 | PANTHER | PTHR11040 | ZINC/IRON TRANSPORTER | 13 | 130 | 4.8E-20 |
| 8 | g7758.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
| 11 | g7758.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 32 | - |
| 6 | g7758.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 33 | 43 | - |
| 10 | g7758.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 44 | 64 | - |
| 9 | g7758.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 65 | 78 | - |
| 12 | g7758.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 97 | - |
| 7 | g7758.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 98 | 163 | - |
| 5 | g7758.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 10 | 32 | - |
| 3 | g7758.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 45 | 64 | - |
| 4 | g7758.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 98 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K14717 (solute carrier family 39 (zinc transporter), member 11)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
