General information for g7767.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative High affinity copper uptake protein 1.
Parent gene
- The parent gene g7767 is located on chr_2: 25871963..25873057 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7767 | g7767.t1 | TSS | g7767.t1 | 25871683 | 25871683 |
| chr_2 | g7767 | g7767.t1 | isoform | g7767.t1 | 25871697 | 25872670 |
| chr_2 | g7767 | g7767.t1 | exon | g7767.t1.exon1 | 25871697 | 25871867 |
| chr_2 | g7767 | g7767.t1 | cds | g7767.t1.CDS1 | 25871697 | 25871867 |
| chr_2 | g7767 | g7767.t1 | exon | g7767.t1.exon2 | 25871928 | 25872157 |
| chr_2 | g7767 | g7767.t1 | cds | g7767.t1.CDS2 | 25871928 | 25872157 |
| chr_2 | g7767 | g7767.t1 | exon | g7767.t1.exon3 | 25872237 | 25872266 |
| chr_2 | g7767 | g7767.t1 | cds | g7767.t1.CDS3 | 25872237 | 25872266 |
| chr_2 | g7767 | g7767.t1 | exon | g7767.t1.exon4 | 25872469 | 25872670 |
| chr_2 | g7767 | g7767.t1 | cds | g7767.t1.CDS4 | 25872469 | 25872670 |
| chr_2 | g7767 | g7767.t1 | TTS | g7767.t1 | 25873093 | 25873093 |
Sequences
>g7767.t1 Gene=g7767 Length=633
ATGGGAGATCACGCACATCATCATCATCATCATATGCCAGACCTTGATGCAACAAGTGCT
ATGCCAGTGCTTTCAACTGGAATGGATCATCATCACATGCATTCCGATATGGGACATTCA
ATGAATGACTCAGCTGCATCTCATGCTTTTCATCACATGATGTCCATGGCTTTTCATGGC
GGTTGCAACGAAACAATTTTATTCACTCAATGGACGATTGACAGTTGCTTTGGTCTTGTG
TGGTCAATGATTGTTATTTTCATTTTTGGTATTCTATATGAAGGTTTAAAATATTATCGT
GAACATTTATTCTGGAAGACTTATAATGCATTGCAATACAGAGCAGTAGGTGCTCCAGAG
AAAAATGGAACATCTGAAAATGCCGATTCACGTGTTGTACATATGGTTGGTGAAGTTGTT
CATCGAAATCCACCAACAATATTTTCACTGATGCATCTTTATCAATCGTTTCTACATTTA
ATTCAAGTAACATTATCACTAATGCTGATGCTCATATTTATGACATACAACACATGGTTA
TGTCTTGCCGTTGTTTTTGGAGCTATGGTAGGATACTTTTTGTTCGGATGGAAGAAATCA
ATAGTAGTCGATGTTACAGAGCATTGTCATTGA
>g7767.t1 Gene=g7767 Length=210
MGDHAHHHHHHMPDLDATSAMPVLSTGMDHHHMHSDMGHSMNDSAASHAFHHMMSMAFHG
GCNETILFTQWTIDSCFGLVWSMIVIFIFGILYEGLKYYREHLFWKTYNALQYRAVGAPE
KNGTSENADSRVVHMVGEVVHRNPPTIFSLMHLYQSFLHLIQVTLSLMLMLIFMTYNTWL
CLAVVFGAMVGYFLFGWKKSIVVDVTEHCH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g7767.t1 | PANTHER | PTHR12483:SF27 | COPPER TRANSPORTER 1A, ISOFORM C-RELATED | 28 | 209 | 8.3E-38 |
| 3 | g7767.t1 | PANTHER | PTHR12483 | SOLUTE CARRIER FAMILY 31 COPPER TRANSPORTERS | 28 | 209 | 8.3E-38 |
| 1 | g7767.t1 | Pfam | PF04145 | Ctr copper transporter family | 56 | 195 | 1.1E-30 |
| 8 | g7767.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 75 | - |
| 12 | g7767.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 96 | - |
| 10 | g7767.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 97 | 152 | - |
| 11 | g7767.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 153 | 172 | - |
| 7 | g7767.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 173 | 178 | - |
| 13 | g7767.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 179 | 197 | - |
| 9 | g7767.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 198 | 210 | - |
| 6 | g7767.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 77 | 96 | - |
| 5 | g7767.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 151 | 173 | - |
| 4 | g7767.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 180 | 197 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0035434 | copper ion transmembrane transport | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0005375 | copper ion transmembrane transporter activity | MF |
KEGG
Orthology
- This transcript has been annotated with K14686 (solute carrier family 31 (copper transporter), member 1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
