General information for g7792.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Alpha-amylase 2.
Parent gene
- The parent gene g7792 is located on chr_2: 26138418..26138790 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7792 | g7792.t1 | isoform | g7792.t1 | 26138418 | 26138790 |
| chr_2 | g7792 | g7792.t1 | exon | g7792.t1.exon1 | 26138418 | 26138586 |
| chr_2 | g7792 | g7792.t1 | cds | g7792.t1.CDS1 | 26138418 | 26138586 |
| chr_2 | g7792 | g7792.t1 | exon | g7792.t1.exon2 | 26138648 | 26138790 |
| chr_2 | g7792 | g7792.t1 | cds | g7792.t1.CDS2 | 26138648 | 26138790 |
| chr_2 | g7792 | g7792.t1 | TSS | g7792.t1 | NA | NA |
| chr_2 | g7792 | g7792.t1 | TTS | g7792.t1 | NA | NA |
Sequences
>g7792.t1 Gene=g7792 Length=312
ATGGTTGAGTGGCGCAATGTTGTTAGTAATGGAGCAGTTTTACATTGGTGGGATAATAGA
GGCAATCAAATTGGATTTAGTCGTGGAAACCGTGGATTTATTGCCTTTAACAACGAAAAT
TACAATATGAATGAATGGTTGGATATAGGATTACCAGCTGGAGTTTATTGCGAAGTGATT
TCAGATGCCAAAATCAATAATGTTTGTACAAGAAAATCAATTACAGTTTACACTAATGGT
TGCGCACATTTTTCCATTTTAACTTCTGATTTTGATGGTGTGATTGCTATACGTATTTAT
GCAAAATTGTGA
>g7792.t1 Gene=g7792 Length=103
MVEWRNVVSNGAVLHWWDNRGNQIGFSRGNRGFIAFNNENYNMNEWLDIGLPAGVYCEVI
SDAKINNVCTRKSITVYTNGCAHFSILTSDFDGVIAIRIYAKL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g7792.t1 | Gene3D | G3DSA:2.60.40.1180 | - | 12 | 103 | 0 |
| 2 | g7792.t1 | PANTHER | PTHR43447 | ALPHA-AMYLASE | 1 | 103 | 0 |
| 3 | g7792.t1 | PANTHER | PTHR43447:SF5 | PANCREATIC ALPHA-AMYLASE | 1 | 103 | 0 |
| 1 | g7792.t1 | Pfam | PF02806 | Alpha amylase, C-terminal all-beta domain | 17 | 98 | 0 |
| 5 | g7792.t1 | SMART | SM00632 | Aamy_c | 14 | 102 | 0 |
| 4 | g7792.t1 | SUPERFAMILY | SSF51011 | Glycosyl hydrolase domain | 13 | 102 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0043169 | cation binding | MF |
| GO:0005975 | carbohydrate metabolic process | BP |
| GO:0003824 | catalytic activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed