General information for g7845.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g7845 is located on chr_2: 26401671..26402619 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g7845 | g7845.t1 | isoform | g7845.t1 | 26401671 | 26402619 |
| chr_2 | g7845 | g7845.t1 | exon | g7845.t1.exon1 | 26401671 | 26401820 |
| chr_2 | g7845 | g7845.t1 | cds | g7845.t1.CDS1 | 26401671 | 26401820 |
| chr_2 | g7845 | g7845.t1 | exon | g7845.t1.exon2 | 26402551 | 26402619 |
| chr_2 | g7845 | g7845.t1 | cds | g7845.t1.CDS2 | 26402551 | 26402619 |
| chr_2 | g7845 | g7845.t1 | TSS | g7845.t1 | NA | NA |
| chr_2 | g7845 | g7845.t1 | TTS | g7845.t1 | NA | NA |
Sequences
>g7845.t1 Gene=g7845 Length=219
ATGGATGATCAACCGAAGGAAGGAGGAGAGGGGGATAAAAAAATTGTTCATACCTATGCA
CTTGTAAAGCATTCAGATATGAGCGACGAGTTGAAAAATGAAGCTATAGAAATCATTACC
ACTGCTTGTGAGAAATATGCACAAAATTATGAACTGGCAGCAAAAATAGTCAAAGAGGCG
ATGGACAAGAATTTGGCACATTCTGGCATTGTTGTGTAG
>g7845.t1 Gene=g7845 Length=72
MDDQPKEGGEGDKKIVHTYALVKHSDMSDELKNEAIEIITTACEKYAQNYELAAKIVKEA
MDKNLAHSGIVV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g7845.t1 | Gene3D | G3DSA:3.30.740.10 | Protein Inhibitor Of Neuronal Nitric Oxide Synthase; | 9 | 71 | 0.0e+00 |
| 2 | g7845.t1 | PANTHER | PTHR11886:SF73 | DYNEIN LIGHT CHAIN 4, AXONEMAL | 1 | 68 | 0.0e+00 |
| 3 | g7845.t1 | PANTHER | PTHR11886 | DYNEIN LIGHT CHAIN | 1 | 68 | 0.0e+00 |
| 1 | g7845.t1 | Pfam | PF01221 | Dynein light chain type 1 | 20 | 64 | 2.0e-07 |
| 5 | g7845.t1 | SMART | SM01375 | Dynein_light_2 | 15 | 72 | 2.1e-03 |
| 4 | g7845.t1 | SUPERFAMILY | SSF54648 | DLC | 11 | 65 | 0.0e+00 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0030286 | dynein complex | CC |
| GO:0007017 | microtubule-based process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed