Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g7935 g7935.t1 TTS g7935.t1 27117161 27117161
chr_2 g7935 g7935.t1 isoform g7935.t1 27117454 27118004
chr_2 g7935 g7935.t1 exon g7935.t1.exon1 27117454 27117590
chr_2 g7935 g7935.t1 cds g7935.t1.CDS1 27117454 27117590
chr_2 g7935 g7935.t1 exon g7935.t1.exon2 27117905 27118004
chr_2 g7935 g7935.t1 cds g7935.t1.CDS2 27117905 27118004
chr_2 g7935 g7935.t1 TSS g7935.t1 27118154 27118154

Sequences

>g7935.t1 Gene=g7935 Length=237
ATGGTGAAAGAATATTTCAAATCACTCTCAAATATTTCAACAAACTCAGTTGATTCAGGA
TATTCTGATGATGAAATCACTGAGGATCAAGATCTCGGAGCTACAATGAAAATTCAAAAC
CCAGATGATGAACTTGATCTCGATGAATACACTGAACTCGAGAATGACATTATTGATTAT
TGTGAAGAATTCTGGTGTGAACCAATTCAACCAATTGTTCGATTACCTCAAGATTGA

>g7935.t1 Gene=g7935 Length=78
MVKEYFKSLSNISTNSVDSGYSDDEITEDQDLGATMKIQNPDDELDLDEYTELENDIIDY
CEEFWCEPIQPIVRLPQD

Protein features from InterProScan

No InterPro annotations for this transcript.

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values