General information for g8046.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative V-type proton ATPase subunit G.
Parent gene
- The parent gene g8046 is located on chr_2: 28207385..28208066 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8046 | g8046.t1 | TTS | g8046.t1 | 28206927 | 28206927 |
| chr_2 | g8046 | g8046.t1 | isoform | g8046.t1 | 28207385 | 28208066 |
| chr_2 | g8046 | g8046.t1 | exon | g8046.t1.exon1 | 28207385 | 28207564 |
| chr_2 | g8046 | g8046.t1 | cds | g8046.t1.CDS1 | 28207385 | 28207564 |
| chr_2 | g8046 | g8046.t1 | exon | g8046.t1.exon2 | 28207812 | 28207912 |
| chr_2 | g8046 | g8046.t1 | cds | g8046.t1.CDS2 | 28207812 | 28207912 |
| chr_2 | g8046 | g8046.t1 | exon | g8046.t1.exon3 | 28207985 | 28208066 |
| chr_2 | g8046 | g8046.t1 | cds | g8046.t1.CDS3 | 28207985 | 28208066 |
| chr_2 | g8046 | g8046.t1 | TSS | g8046.t1 | 28208156 | 28208156 |
Sequences
>g8046.t1 Gene=g8046 Length=363
ATGGCAAGTCAAACTCAAGGCATTCAACAATTACTTGCAGCTGAAAAACGTGCAGCAGAA
AAAGTTTCTGAAGCCAGAAAACGTAAACAAAAGCGATTAAAACAAGCAAAAGAAGAAGCT
CAAGATGAAATTGAAAAATATAGACAAGAACGTGAAAGACAATTTAAAGAATTTGAGGCA
AAGCATATGGGATCACGTGAAGGTGTAGCAGCAAAAATTGATGCTGATACAGTAGTCAAA
ATTGAAGACATGACTCGTGCAATACACTCTAATAAGAATTTGGTCATTCAAGATGTTCTC
TCTTTGGTTTATGATATCTCACCCGAAGTTCATAAGAATTATTTATTGAAGATGAAAAAT
TAA
>g8046.t1 Gene=g8046 Length=120
MASQTQGIQQLLAAEKRAAEKVSEARKRKQKRLKQAKEEAQDEIEKYRQERERQFKEFEA
KHMGSREGVAAKIDADTVVKIEDMTRAIHSNKNLVIQDVLSLVYDISPEVHKNYLLKMKN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g8046.t1 | Coils | Coil | Coil | 8 | 57 | - |
| 5 | g8046.t1 | Gene3D | G3DSA:1.20.5.620 | F1F0 ATP synthase subunit B | 1 | 60 | 1.5E-25 |
| 4 | g8046.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 19 | 45 | - |
| 2 | g8046.t1 | PANTHER | PTHR12713:SF12 | V-TYPE PROTON ATPASE SUBUNIT G 1 | 1 | 115 | 1.6E-34 |
| 3 | g8046.t1 | PANTHER | PTHR12713 | VACUOLAR ATP SYNTHASE SUBUNIT G | 1 | 115 | 1.6E-34 |
| 1 | g8046.t1 | Pfam | PF03179 | Vacuolar (H+)-ATPase G subunit | 3 | 106 | 9.5E-39 |
| 7 | g8046.t1 | TIGRFAM | TIGR01147 | V_ATP_synt_G: V-type ATPase, G subunit | 1 | 113 | 7.7E-48 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:1902600 | proton transmembrane transport | BP |
| GO:0042626 | ATPase-coupled transmembrane transporter activity | MF |
| GO:0016471 | vacuolar proton-transporting V-type ATPase complex | CC |
KEGG
Orthology
- This transcript has been annotated with K02152 (V-type H+-transporting ATPase subunit G)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
