| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g8067 | g8067.t2 | TTS | g8067.t2 | 28397737 | 28397737 |
| chr_2 | g8067 | g8067.t2 | isoform | g8067.t2 | 28398145 | 28401068 |
| chr_2 | g8067 | g8067.t2 | exon | g8067.t2.exon1 | 28398145 | 28398161 |
| chr_2 | g8067 | g8067.t2 | cds | g8067.t2.CDS1 | 28398145 | 28398161 |
| chr_2 | g8067 | g8067.t2 | exon | g8067.t2.exon2 | 28400067 | 28400341 |
| chr_2 | g8067 | g8067.t2 | cds | g8067.t2.CDS2 | 28400067 | 28400341 |
| chr_2 | g8067 | g8067.t2 | exon | g8067.t2.exon3 | 28401040 | 28401068 |
| chr_2 | g8067 | g8067.t2 | cds | g8067.t2.CDS3 | 28401040 | 28401068 |
| chr_2 | g8067 | g8067.t2 | TSS | g8067.t2 | 28401654 | 28401654 |
>g8067.t2 Gene=g8067 Length=321
ATGGCAGATCAAGGAACATCAAATGGAGCCGGATCAACTGGTACTCAGAATAATAATAAT
CGTCTCAAACAAACACAACAAAAAGTCGATGAAGTCGTGGGAATCATGCGAGTAAATGTT
GAAAAAGTATTAGAGCGTGATCAGAAACTGTCTGAACTGGATCATCGAGCTGACGCTTTA
CAACATGGTGCATCACAATTTGAACAACAGGCTGGTAAATTAAAGAGAAAACAATGGTGG
GCGAACATGAAAATGATGATTATAATGGGAGTCATTGGTGTTATCCTATTAATCATCATC
ATAGTTCTTCTCTTCAAATAA
>g8067.t2 Gene=g8067 Length=106
MADQGTSNGAGSTGTQNNNNRLKQTQQKVDEVVGIMRVNVEKVLERDQKLSELDHRADAL
QHGASQFEQQAGKLKRKQWWANMKMMIIMGVIGVILLIIIIVLLFK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g8067.t2 | CDD | cd15870 | R-SNARE_VAMP2 | 21 | 82 | 1.64873E-31 |
| 8 | g8067.t2 | Gene3D | G3DSA:1.20.5.110 | - | 1 | 105 | 6.7E-45 |
| 15 | g8067.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 24 | - |
| 2 | g8067.t2 | PANTHER | PTHR45701:SF10 | SYNAPTOBREVIN | 6 | 104 | 5.5E-53 |
| 3 | g8067.t2 | PANTHER | PTHR45701 | SYNAPTOBREVIN FAMILY MEMBER | 6 | 104 | 5.5E-53 |
| 12 | g8067.t2 | PIRSF | PIRSF005409 | VAMP-5_synaptobrevin | 1 | 106 | 7.2E-40 |
| 5 | g8067.t2 | PRINTS | PR00219 | Synaptobrevin signature | 26 | 45 | 4.8E-29 |
| 6 | g8067.t2 | PRINTS | PR00219 | Synaptobrevin signature | 46 | 65 | 4.8E-29 |
| 4 | g8067.t2 | PRINTS | PR00219 | Synaptobrevin signature | 82 | 101 | 4.8E-29 |
| 1 | g8067.t2 | Pfam | PF00957 | Synaptobrevin | 19 | 105 | 3.4E-34 |
| 9 | g8067.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 84 | - |
| 11 | g8067.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 85 | 105 | - |
| 10 | g8067.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 106 | 106 | - |
| 16 | g8067.t2 | ProSiteProfiles | PS50892 | v-SNARE coiled-coil homology domain profile. | 21 | 81 | 17.415 |
| 7 | g8067.t2 | SUPERFAMILY | SSF58038 | SNARE fusion complex | 17 | 83 | 3.09E-20 |
| 14 | g8067.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 86 | 105 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
| GO:0016192 | vesicle-mediated transport | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.